254780682

254780682

hypothetical protein CLIBASIA_02845

GeneID in NCBI database:8209686Locus tag:CLIBASIA_02845
Protein GI in NCBI database:254780682Protein Accession:YP_003065095.1
Gene range:-(585492, 586091)Protein Length:199aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSPTDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNIHHKKNKPRLHCQ
cccEEEEHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEEccHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEcccccccccccEEccccccccccccccHHccccEEEEccHHHHHHHHHHccccccccc
ccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccHccHHEEcccHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEccccHHHHccccccccccccc
MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIililsptdctantanilipsrkIIDYHRLLEQKknhnlqyslinipsqnkqespknanNNILDHIALLKERLRTdintfdntnletkiplpnnlkpnvcvkekklipprkninnlkdtnhrlkiknnqeiknihhkknkprlhcq
MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSPTDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLRTDINTFDntnletkiplpnnlkpnvcvkekklipprkninnlkdtnhrlkiknnqeiknihhkknkprlhcq
MRSTilflikhklklhkNIMSKGKINESFWYIRTLFPYLSHQIHKALMsissgiililsPTDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNIHHKKNKPRLHCQ
**STILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSPTDCTANTANILIPSRKIIDYHRLLE********************************HIALLKERLRTDINTFDNTNLETKIPLPNNLKPNVC*******************NHRLKIKN*Q*****************
MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSPTDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNIHH**********
*RSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSPTDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNIH***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSPTDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNxxxxxxxxxxxxxxxxxxxxxIHHKKNKPRLHCQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target199 hypothetical protein CLIBASIA_02845 [Candidatus Liberib
315122207 344 Peptidase M23 [Candidatus Liberibacter solanacearum CLs 1 2e-09
>gi|315122207|ref|YP_004062696.1| Peptidase M23 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 344 Back     alignment and organism information
 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 88/182 (48%), Gaps = 30/182 (16%)

Query: 44  HKALMSISSGIILILSPTDCTANTANILIPSRKIIDYH-RLLEQKKNHNLQYSLINIPSQ 102
           +K L       +LIL  T    N  NIL+   KI +YH RL+EQK N   Q  +I IP  
Sbjct: 12  YKILAKTIFCFLLILVSTSDKTNAENILVLPSKITNYHNRLVEQKNNPEKQ--VIPIPLP 69

Query: 103 NKQESPKNANNNILDHIALLKERLRTDINT-FDNTNLETKIPLP----------NNLKPN 151
            KQE P N NN  +D   LL ++   D N  + +  L  KIPLP          N+L  N
Sbjct: 70  TKQEYPSNTNNKTIDQNTLLAKKGFVDKNNLYSSMYLSKKIPLPNKCLLFPPDNNSLHLN 129

Query: 152 VCVKEKKLIPPRKNINNLK--------------DTNHRLKIKNNQEIKNIHHKKN--KPR 195
            C++ K     +KNI++ +              +     K+KNNQ+IK+I +KKN   P+
Sbjct: 130 NCIENKSPNSSKKNISHTRKIPKYKKNNPKKSGNIAPAFKVKNNQKIKHIQYKKNNYSPQ 189

Query: 196 LH 197
           +H
Sbjct: 190 IH 191


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00