254780683

254780683

lipoprotein

GeneID in NCBI database:8209687Locus tag:CLIBASIA_02850
Protein GI in NCBI database:254780683Protein Accession:YP_003065096.1
Gene range:-(585069, 585323)Protein Length:84aa
Gene description:lipoprotein
COG prediction:[M] Membrane proteins related to metalloendopeptidases
KEGG prediction:lipoprotein
SEED prediction:lipoprotein precursor protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80----
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEKIP
EEEEEcccccccccEEEEEccccEEEEEEEccEEEEccccEEEcccEEEEEEccccccccEEEEEEEEccEEccHHHHHHHccc
cEEEEcccccccccEEEEEccccEEEEEEccccEEEEcccEEccccEEEEEcccccccccEEEEEEEEcccccccHHHcccccc
MVIYVGNDLVELgntilirhddsivtvyshidtpyvqkgqkvsrghtiglsgksgnaqhpQVHFELRknaiamdpIKFLEEKIP
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGlsgksgnaqHPQVHFELrknaiamdPIKFLEEKIP
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEKIP
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEE***
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEKIP
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiii
iiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEKIP
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEKIP
MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEKIP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
254780879652 hypothetical protein CLIBASIA_03880 [Candidatus Li 2e-06
>gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Back     alignment
 Score = 42.0 bits (97), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 2   VIYVGNDLVE-------LGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSG 52
           ++ VG+ +VE        G   LI H +  V+ Y+H D     ++ G  V +G  IG  G
Sbjct: 526 IVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIG 585

Query: 53  KSGNAQHPQVHFELRKNAIAMDPIK 77
            +G +  P +H+EL  N I +D  K
Sbjct: 586 TTGLSTGPHLHYELIVNGIKVDSTK 610

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
315122207344 Peptidase M23 [Candidatus Liberibacter solanacearum CLs 1 1e-27
218460656161 lipoprotein precursor protein [Rhizobium etli Kim 5] Le 1 3e-21
218677890160 putative peptidase [Rhizobium etli CIAT 894] Length = 1 1 4e-21
222148964538 lipoprotein [Agrobacterium vitis S4] Length = 538 1 6e-21
327189125537 lipoprotein precursor protein [Rhizobium etli CNPAF512] 1 7e-21
86357457529 lipoprotein precursor protein [Rhizobium etli CFN 42] L 1 7e-21
222085791572 lipoprotein precursor protein [Agrobacterium radiobacte 1 8e-21
190891518529 lipoprotein precursor protein [Rhizobium etli CIAT 652] 1 8e-21
241204421534 peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM 1 9e-21
209549094530 peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM 1 9e-21
>gi|315122207|ref|YP_004062696.1| Peptidase M23 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 344 Back     alignment and organism information
 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/81 (72%), Positives = 72/81 (88%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIYVGNDL+ELG+ ILIRHD+ +VTVYSHI+TPYVQKGQKVSRGHTIG+S  S + +  
Sbjct: 255 IVIYVGNDLIELGDMILIRHDNEMVTVYSHINTPYVQKGQKVSRGHTIGISRISDDKKIS 314

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           +VHFELR+NAIA+DPI FLE+
Sbjct: 315 KVHFELRQNAIAVDPIAFLEK 335


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218460656|ref|ZP_03500747.1| lipoprotein precursor protein [Rhizobium etli Kim 5] Length = 161 Back     alignment and organism information
>gi|218677890|ref|ZP_03525787.1| putative peptidase [Rhizobium etli CIAT 894] Length = 160 Back     alignment and organism information
>gi|222148964|ref|YP_002549921.1| lipoprotein [Agrobacterium vitis S4] Length = 538 Back     alignment and organism information
>gi|327189125|gb|EGE56310.1| lipoprotein precursor protein [Rhizobium etli CNPAF512] Length = 537 Back     alignment and organism information
>gi|86357457|ref|YP_469349.1| lipoprotein precursor protein [Rhizobium etli CFN 42] Length = 529 Back     alignment and organism information
>gi|222085791|ref|YP_002544321.1| lipoprotein precursor protein [Agrobacterium radiobacter K84] Length = 572 Back     alignment and organism information
>gi|190891518|ref|YP_001978060.1| lipoprotein precursor protein [Rhizobium etli CIAT 652] Length = 529 Back     alignment and organism information
>gi|241204421|ref|YP_002975517.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 534 Back     alignment and organism information
>gi|209549094|ref|YP_002281011.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 530 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
COG0739277 COG0739, NlpD, Membrane proteins related to metalloendo 1e-15
PRK11649439 PRK11649, PRK11649, putative peptidase; Provisional 5e-11
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase [Cell 8e-11
PRK10871319 PRK10871, nlpD, lipoprotein NlpD; Provisional 2e-10
PRK11637428 PRK11637, PRK11637, AmiB activator; Provisional 7e-04
pfam0155196 pfam01551, Peptidase_M23, Peptidase family M23 2e-17
>gnl|CDD|31082 COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183257 PRK11649, PRK11649, putative peptidase; Provisional Back     alignment and domain information
>gnl|CDD|34550 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|182796 PRK10871, nlpD, lipoprotein NlpD; Provisional Back     alignment and domain information
>gnl|CDD|183249 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|144954 pfam01551, Peptidase_M23, Peptidase family M23 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
PRK11637404 hypothetical protein; Provisional 100.0
PRK10871374 nlpD lipoprotein NlpD; Provisional 99.97
PRK11649418 hypothetical protein; Provisional 99.96
COG4942420 Membrane-bound metallopeptidase [Cell division and chro 99.93
COG0739277 NlpD Membrane proteins related to metalloendopeptidases 99.92
pfam0155196 Peptidase_M23 Peptidase family M23. Members of this fam 99.88
PRK06148 1015 hypothetical protein; Provisional 98.77
PRK06149 972 hypothetical protein; Provisional 96.35
TIGR01843 434 type_I_hlyD type I secretion membrane fusion protein, H 90.65
>PRK11637 hypothetical protein; Provisional Back     alignment and domain information
>PRK10871 nlpD lipoprotein NlpD; Provisional Back     alignment and domain information
>PRK11649 hypothetical protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0739 NlpD Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam01551 Peptidase_M23 Peptidase family M23 Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
2hsi_A282 Crystal Structure Of Putative Peptidase M23 From Ps 9e-10
2gu1_A361 Crystal Structure Of A Zinc Containing Peptidase Fr 1e-08
1qwy_A291 Latent Lytm At 1.3 A Resolution Length = 291 8e-08
2b44_A133 Truncated S. Aureus Lytm, P 32 2 1 Crystal Form Len 8e-08
2b0p_A134 Truncated S. Aureus Lytm, P212121 Crystal Form Leng 9e-08
gi|114794497|pdb|2HSI|A Chain A, Crystal Structure Of Putative Peptidase M23 From Pseudomonas Aeruginosa, New York Structural Genomics Consortium Length = 282 Back     alignment and structure
 Score = 66.7 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI +G D    G T+ + H    ++++ H+    V+ GQ+V RG  +G  G +G A  P 
Sbjct: 201 VILIG-DYFFNGKTVFVDHGQGFISMFCHLSKIDVKLGQQVPRGGVLGKVGATGRATGPH 259

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+ +  N   +DP  F+
Sbjct: 260 MHWNVSLNDARVDPAIFI 277


>gi|110590412|pdb|2GU1|A Chain A, Crystal Structure Of A Zinc Containing Peptidase From Vibrio Cholerae Length = 361 Back     alignment and structure
>gi|42543452|pdb|1QWY|A Chain A, Latent Lytm At 1.3 A Resolution Length = 291 Back     alignment and structure
>gi|88192221|pdb|2B44|A Chain A, Truncated S. Aureus Lytm, P 32 2 1 Crystal Form Length = 133 Back     alignment and structure
>gi|88192192|pdb|2B0P|A Chain A, Truncated S. Aureus Lytm, P212121 Crystal Form Length = 134 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
1qwy_A291 Peptidoglycan hydrolase; LYTM lysostaphin metalloprotea 1e-16
2hsi_A282 Putative peptidase M23; structural genomics, PSI, prote 1e-14
3nyy_A252 Putative glycyl-glycine endopeptidase LYTM; structural 1e-13
3csq_A334 Morphogenesis protein 1; hydrolase, infection, late pro 4e-13
2gu1_A361 Zinc peptidase; alpha/beta, beta barrel, structural gen 4e-12
3it5_A182 Protease LASA; metallopeptidase, beta-protein, cell mem 3e-07
>1qwy_A Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} SCOP: b.84.3.2 PDB: 2b0p_A 2b13_A* 2b44_A Length = 291 Back     alignment and structure
 Score = 79.7 bits (196), Expect = 1e-16
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 5/86 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDS-IVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           V+  G      GN + I+  +S     Y H +   V  G KV  G  I  SG +GN+  P
Sbjct: 206 VVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAP 265

Query: 61  QVHFELRKNAI----AMDPIKFLEEK 82
            VHF+     I    A+DP  +L+ +
Sbjct: 266 HVHFQRMSGGIGNQYAVDPTSYLQSR 291


>2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} Length = 282 Back     alignment and structure
>3nyy_A Putative glycyl-glycine endopeptidase LYTM; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE 2PE SO4; 1.60A {Ruminococcus gnavus} Length = 252 Back     alignment and structure
>3csq_A Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29} Length = 334 Back     alignment and structure
>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Length = 361 Back     alignment and structure
>3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A* Length = 182 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
2gu1_A361 Zinc peptidase; alpha/beta, beta barrel, structural gen 99.97
2hsi_A282 Putative peptidase M23; structural genomics, PSI, prote 99.95
1qwy_A291 Peptidoglycan hydrolase; LYTM lysostaphin metalloprotea 99.93
3nyy_A252 Putative glycyl-glycine endopeptidase LYTM; structural 99.88
3it5_A182 Protease LASA; metallopeptidase, beta-protein, cell mem 99.85
3csq_A334 Morphogenesis protein 1; hydrolase, infection, late pro 99.69
>2gu1_A Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
Probab=99.97  E-value=1.1e-31  Score=186.70  Aligned_cols=77  Identities=36%  Similarity=0.558  Sum_probs=75.0

Q ss_pred             CEEEECCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECCEECCHHHH
Q ss_conf             599960698655119999989988998411563441120022031248998057888885699999786898052698
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKF   78 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g~~t~Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g~~vdP~~~   78 (84)
                      +|+|+||+ .+|||+|+|+|++||.|+|+||+++.|++||+|++||+||+||+||.++|||||||||++|+++||+..
T Consensus       252 ~V~~ag~~-~gyGn~V~I~H~~g~~T~YaHls~~~V~~G~~V~~Gq~Ig~vG~TG~stgphLHFEvr~~g~~vdPl~~  328 (361)
T 2gu1_A          252 KVIVVRKH-PYAGNYLVIEHNSVYKTRYLHLDKILVKKGQLVKRGQKIALAGATGRLTGPHLHFEVLVRNRPVDAMKA  328 (361)
T ss_dssp             EEEEEEEE-TTTEEEEEEECSSSEEEEEEEESEECCCTTCEECTTCEEEECCCCSSCSSCCEEEEEEETTEEECTTCS
T ss_pred             EEEEEEEC-CCCCCEEEEECCCCEEEEEECCCCCCCCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCEECCCCCC
T ss_conf             89999864-788875899879985999844511133889999979999987688998986789999989989699635



>2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1qwy_A Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} SCOP: b.84.3.2 PDB: 2b0p_A 2b13_A* 2b44_A Back     alignment and structure
>3nyy_A Putative glycyl-glycine endopeptidase LYTM; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE 2PE SO4; 1.60A {Ruminococcus gnavus} Back     alignment and structure
>3it5_A Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A* Back     alignment and structure
>3csq_A Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
d1qwya_270 b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococ 6e-16
>d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]} Length = 270 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Duplicated hybrid motif
family: Peptidoglycan hydrolase LytM
domain: Peptidoglycan hydrolase LytM
species: Staphylococcus aureus [TaxId: 1280]
 Score = 76.6 bits (188), Expect = 6e-16
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDS-IVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           V+  G      GN + I+  +S     Y H +   V  G KV  G  I  SG +GN+  P
Sbjct: 187 VVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAP 246

Query: 61  QVHFELRKNAI----AMDPIKFLE 80
            VHF+     I    A+DP  +L+
Sbjct: 247 HVHFQRMSGGIGNQYAVDPTSYLQ 270


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
d1qwya_270 Peptidoglycan hydrolase LytM {Staphylococcus aureus [Ta 99.92
d1ci3m262 Cytochrome f, small domain {Phormidium laminosum [TaxId 91.01
d1e2wa264 Cytochrome f, small domain {Chlamydomonas reinhardtii [ 90.86
>d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Duplicated hybrid motif
family: Peptidoglycan hydrolase LytM
domain: Peptidoglycan hydrolase LytM
species: Staphylococcus aureus [TaxId: 1280]
Probab=99.92  E-value=9.5e-26  Score=154.06  Aligned_cols=80  Identities=33%  Similarity=0.510  Sum_probs=74.2

Q ss_pred             CEEEECCCCCCCCEEEEEECCCC-EEEEEECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECC----EECCH
Q ss_conf             59996069865511999998998-89984115634411200220312489980578888856999997868----98052
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDS-IVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA----IAMDP   75 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g-~~t~Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g----~~vdP   75 (84)
                      +|+++++...++|++|+|+|+++ +.++|+||+++.|++||.|++||+||++|+||++++||||||||+++    ++|||
T Consensus       186 ~V~~ag~~~~g~G~~V~I~h~~g~~~t~Y~hl~~~~V~~Gq~V~~Gq~IG~vGsTG~stgpHLHFEi~~~g~~~~~~VDP  265 (270)
T d1qwya_         186 TVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDP  265 (270)
T ss_dssp             EEEEEEEETTTTEEEEEEEETTSSEEEEEEEESEECCCTTCEECTTCEEEECCCCSSCSSSEEEEEEEESEESGGGEECC
T ss_pred             EEEEEEECCCCCCEEEEEEECCCCEEEEEEECCEEECCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCCCCCEEECC
T ss_conf             99998975679986999970898879999837721138899998689999967889989977999999899179768394


Q ss_pred             HHHHH
Q ss_conf             69875
Q gi|254780683|r   76 IKFLE   80 (84)
Q Consensus        76 ~~~l~   80 (84)
                      ++||+
T Consensus       266 ~~~Lk  270 (270)
T d1qwya_         266 TSYLQ  270 (270)
T ss_dssp             HHHHC
T ss_pred             HHHHC
T ss_conf             79739



>d1ci3m2 b.84.2.2 (M:170-231) Cytochrome f, small domain {Phormidium laminosum [TaxId: 32059]} Back     information, alignment and structure
>d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 84 lipoprotein [Candidatus Liberibacter asiaticus str
2gu1_A_206-361156 (A:206-361) Zinc peptidase; alpha/beta, beta barre 2e-13
1qwy_A_83-291209 (A:83-291) Peptidoglycan hydrolase; LYTM lysostaph 1e-12
3it5_A_1-134_171-182146 (A:1-134,A:171-182) Protease LASA; metallopeptidas 4e-12
2hsi_A_116-267152 (A:116-267) Putative peptidase M23; structural gen 5e-12
3csq_A_166-334169 (A:166-334) Morphogenesis protein 1; hydrolase, in 7e-12
>2gu1_A (A:206-361) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae}Length = 156 Back     alignment and structure
 Score = 68.6 bits (167), Expect = 2e-13
 Identities = 26/78 (33%), Positives = 38/78 (48%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
            + V       GN ++I H+    T Y H+D   V+KGQ V RG  I L+G +G    P 
Sbjct: 47  KVIVVRKHPYAGNYLVIEHNSVYKTRYLHLDKILVKKGQLVKRGQKIALAGATGRLTGPH 106

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+      +D +K  
Sbjct: 107 LHFEVLVRNRPVDAMKAD 124


>1qwy_A (A:83-291) Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp}Length = 209 Back     alignment and structure
>3it5_A (A:1-134,A:171-182) Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A*Length = 146 Back     alignment and structure
>2hsi_A (A:116-267) Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1}Length = 152 Back     alignment and structure
>3csq_A (A:166-334) Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29}Length = 169 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target84 lipoprotein [Candidatus Liberibacter asiaticus str. psy
1qwy_A_83-291209 Peptidoglycan hydrolase; LYTM lysostaphin metallop 99.91
2gu1_A_206-361156 Zinc peptidase; alpha/beta, beta barrel, structura 99.89
2hsi_A_116-267152 Putative peptidase M23; structural genomics, PSI, 99.83
3csq_A_166-334169 Morphogenesis protein 1; hydrolase, infection, lat 99.83
3it5_A_1-134_171-182146 Protease LASA; metallopeptidase, beta-protein, cel 99.82
1ci3_M_170-23162 Protein (cytochrome F); electron transfer protein, 91.16
2a6h_C_593-65967 DNA-directed RNA polymerase beta chain; RNA polyme 91.04
2jxm_B_171-23161 Cytochrome F; copper, electron transport, metal-bi 90.58
>1qwy_A (A:83-291) Peptidoglycan hydrolase; LYTM lysostaphin metalloprotease asparagine switch; 1.30A {Staphylococcus aureus subsp} Back     alignment and structure
Probab=99.91  E-value=3.8e-25  Score=152.93  Aligned_cols=82  Identities=32%  Similarity=0.501  Sum_probs=74.2

Q ss_pred             CEEEECCCCCCCCEEEEEECCCCEEEE-EECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECC----EECCH
Q ss_conf             599960698655119999989988998-4115634411200220312489980578888856999997868----98052
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDSIVTV-YSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA----IAMDP   75 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g~~t~-Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g----~~vdP   75 (84)
                      +|++++++....|++|+|+|++++.++ |+|++++.|++||.|++||.||++|+||++++|||||||++++    +++||
T Consensus       123 ~V~~~~~~~~~gg~~V~i~h~~~~~t~~y~~~~~~~V~~G~~V~~Gq~IG~~G~tg~s~gpHLHfei~~~g~~~~~~vdP  202 (209)
T 1qwy_A          123 TVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDP  202 (209)
T ss_dssp             EEEEEEEETTTTEEEEEEEETTSSEEEEEEEESEECCCTTCEECTTCEEEECCCCSSCSSSEEEEEEEESEESGGGEECC
T ss_pred             EEEEEEECCCCCCEEEEEEECCCCEEEEEEECCCCCCCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCCCCCEECCC
T ss_conf             99998874678986999984899889997878825668889999789999868889989866899999899179877286


Q ss_pred             HHHHHCC
Q ss_conf             6987503
Q gi|254780683|r   76 IKFLEEK   82 (84)
Q Consensus        76 ~~~l~~k   82 (84)
                      ++||++|
T Consensus       203 ~~~l~~r  209 (209)
T 1qwy_A          203 TSYLQSR  209 (209)
T ss_dssp             HHHHC--
T ss_pred             HHHHHCC
T ss_conf             9970159



>2gu1_A (A:206-361) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae} Back     alignment and structure
>2hsi_A (A:116-267) Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3csq_A (A:166-334) Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29} Back     alignment and structure
>3it5_A (A:1-134,A:171-182) Protease LASA; metallopeptidase, beta-protein, cell membrane, cell outer membrane, hydrolase, membrane, metal-binding; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 3it7_A* Back     alignment and structure
>1ci3_M (M:170-231) Protein (cytochrome F); electron transfer protein, complex subunit; HET: HEM; 1.90A {Phormidium laminosum} Back     alignment and structure
>2a6h_C (C:593-659) DNA-directed RNA polymerase beta chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} Back     alignment and structure
>2jxm_B (B:171-231) Cytochrome F; copper, electron transport, metal-binding, transport; HET: HEC; NMR {Prochlorothrix hollandica} Back     alignment and structure