254780684

254780684

flagellum-specific ATP synthase

GeneID in NCBI database:8209688Locus tag:CLIBASIA_02855
Protein GI in NCBI database:254780684Protein Accession:YP_003065097.1
Gene range:+(582824, 584140)Protein Length:438aa
Gene description:flagellum-specific ATP synthase
COG prediction:none
KEGG prediction:fliI; flagellum-specific ATP synthase (EC:3.6.3.14); K02412 flagellum-specific ATP synthase [EC:3.6.3.14]
SEED prediction:Flagellum-specific ATP synthase FliI
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ
ccccHHHHHHHHHHccccHHHccEEEEEEEEEEEEEEccccccccccEEEEEcccccEEEEEEEEcccEEEEEEcccccccccccEEEEccccEEccccccEEEEEEcccccccccccccccccccccccccccHHHHccccccccccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccccEEEEEEEEEcccccccHHHHHHHEEEEEEEEEEHHHHHccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHc
ccccccccccHHHHHHHHHHHcHHHHHcccccccccccccccccccccEEEEcccccccHHHHHHccccEEEEEccccccccccEEEEcccccEccccccccccEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEcccccccccccEEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccEEEEEEEEEccccccccEEccHHHHHHHHHHHccHHcEEEEEEcHHHHHHcHHHHHHHHcccccccccccccccccccHHHHEccHccccEcEEEEEEEEcHHHccccHHHHHHHHHccEEEEEcHHHHHccccccEcccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccEEccHHccc
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFvvhqgknsdnlgqvIRINLDIVYicpvgigeeislgdlvfhwgrfrispsacwcgrvinalgkpidgddslgkgdlsmeimskvppamnrqrVEKGFKTGIRVIDIftplchgqrigvfagsgigkstLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVAtsdespilrkmaPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIAtnsgelpvargyptsvfsELPRLlerigpsekekgnITAVISVLVdgdnhndpiadSVRSILDGHIVLNrslaeegryppvdplasvsrlADKAWSADEKKLVSSLTHLIHRFEETrdirliggyrpgvDLILDKAVHQVPIIYDflkqspsdlsseDVFQEITKKLQ
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMskvppamnrqrVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEdylgdnlkkSVVVVatsdespilrkmapLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIatnsgelpvargyptSVFSELPRLLErigpsekekgNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRslaeegryppvdpLASVSRLADKAWSADEKKLVSSLTHLIHrfeetrdirliGGYRPGVDLILDKAVHQVPIIYDFlkqspsdlssEDVFQEITKKLQ
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIdgddslgkgdlsMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ
*********QLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKL*
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ
**KNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEI**KLQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ
MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKKLQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target438 flagellum-specific ATP synthase [Candidatus Liberibacte
254780615478 F0F1 ATP synthase subunit beta [Candidatus Liberib 9e-33
254780617509 F0F1 ATP synthase subunit alpha [Candidatus Liberi 5e-26
254780810423 transcription termination factor Rho [Candidatus L 3e-13
>gi|254780615|ref|YP_003065028.1| F0F1 ATP synthase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Back     alignment
 Score =  132 bits (333), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 96/334 (28%), Positives = 166/334 (49%), Gaps = 25/334 (7%)

Query: 81  ISLGDLVFHWG-RFRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQ 139
           +S GD V   G +  +       GR++N +G+P+D   ++   +     + +  P+   Q
Sbjct: 69  LSRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSE--KRAIHQPSPSYTEQ 126

Query: 140 RVEKG-FKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL----SMFARSDCFDKVIISL 194
             +     TGI+VID+ +P   G +IG+F G+G+GK+ L+    +  A++     V    
Sbjct: 127 STDASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAG- 185

Query: 195 VGERGREVREFIEDYLGDNLK-------------KSVVVVATSDESPILRKMAPLTAVTI 241
           VGER RE  +   + +   +              K  ++    +E P  R    LT +T+
Sbjct: 186 VGERTREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTV 245

Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSE 301
           AE+F  +G +VL  +D+I RF  +  EI+   G +P A GY +++  E+  L ERI  + 
Sbjct: 246 AEHFRDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERI--TT 303

Query: 302 KEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLA 361
             KG+IT+V ++ V  D+  DP   +  + LD   VL+R ++E+G YP +DPL S S + 
Sbjct: 304 TLKGSITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSML 363

Query: 362 DKAWSADEKKLVS-SLTHLIHRFEETRDIRLIGG 394
           +      E   V+  +  ++ R++  +DI  I G
Sbjct: 364 EIDIVGQEHYDVARRVQEILQRYKSLQDIIAILG 397

>gi|254780617|ref|YP_003065030.1| F0F1 ATP synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Back     alignment
 Score =  110 bits (275), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 97/345 (28%), Positives = 158/345 (45%), Gaps = 25/345 (7%)

Query: 60  GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSAC-WCGRVINALGKPIDGDDS 118
           G  + + +D V +  +G  +EIS GD+V   GR    P      GRV++ALG PIDG   
Sbjct: 61  GMALNLEVDNVGVVILGSYKEISEGDIVKRTGRIVDVPVGLELLGRVVDALGNPIDG--- 117

Query: 119 LGKGDLSMEIMS----KVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGK 174
             KG +  E  S      P  + RQ V +   TGI+ ID   P+  GQR  +      GK
Sbjct: 118 --KGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGK 175

Query: 175 STLL--SMFARSDCFDK--------VIISLVGERGREVREFIEDYLGDN--LKKSVVVVA 222
           ++++  +   +    DK         I   +G++   V  F++  L D   L  S+VVVA
Sbjct: 176 TSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVK-ALEDRGALSYSIVVVA 234

Query: 223 TSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGY 282
           ++ +   ++ +AP     + EYF   G + L+  D + + A + R+++      P    Y
Sbjct: 235 SASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAY 294

Query: 283 PTSVFSELPRLLERIGPSEKE--KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNR 340
           P  VF    RLLER          G++TA+  +    ++ +  I  +V SI DG I L  
Sbjct: 295 PGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVNDVSAYIPTNVISITDGQIFLET 354

Query: 341 SLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEE 385
            L  +G  P ++   SVSR+   A     K++  ++   + ++ E
Sbjct: 355 ELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYRE 399

>gi|254780810|ref|YP_003065223.1| transcription termination factor Rho [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 121/259 (46%), Gaps = 30/259 (11%)

Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS------DCFDKVIISLVGERGREVR 203
           RVID+  P+  GQR  + A    GK+ LL   A S      +C+  +I+ L+ ER  EV 
Sbjct: 163 RVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECY--LIVLLIDERPEEVT 220

Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263
           +      G+      V+ +T DES           +  A+     G +V+++LDSITR  
Sbjct: 221 DMQRSVQGE------VISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLC 274

Query: 264 HSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD-GDNHND 322
            +   +  +SG++ +  G   +   + P+       + KE G++T + + LVD G   ++
Sbjct: 275 RAYNVLMPSSGKI-LTGGVDANAL-QRPKRFFGAARNIKEGGSLTIIGTALVDTGSRMDE 332

Query: 323 PIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADE-------KKLVSS 375
            I +  +   +  IVL R +A++  +P +D + S +R  D      +       +++VSS
Sbjct: 333 VIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKEDLLVERQDLQKVFMLRRIVSS 392

Query: 376 LT------HLIHRFEETRD 388
           +        LI + ++T+D
Sbjct: 393 MNSSDAIEFLIDKLKQTKD 411

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target438 flagellum-specific ATP synthase [Candidatus Liberibacte
315121851449 flagellum-specific ATP synthase [Candidatus Liberibacte 1 0.0
222084860462 H(+)-transporting ATP synthase [Agrobacterium radiobact 1 1e-166
227820853466 flagellum-specific ATP synthase [Sinorhizobium fredii N 1 1e-165
15887903473 flagellum-specific ATP synthase [Agrobacterium tumefaci 1 1e-164
325291944468 flagellum-specific ATP synthase [Agrobacterium sp. H13- 1 1e-164
209547923465 flagellum-specific ATP synthase [Rhizobium leguminosaru 1 1e-163
15964410467 flagellum-specific ATP synthase [Sinorhizobium meliloti 1 1e-162
2916791467 flagellar export apparatus protein [Sinorhizobium melil 1 1e-162
327193032464 H(+)-transporting ATP synthase, flagellum-specific prot 1 1e-161
190890358464 H(+)-transporting ATP synthase, flagellum-specific prot 1 1e-161
>gi|315121851|ref|YP_004062340.1| flagellum-specific ATP synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 449 Back     alignment and organism information
 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/438 (84%), Positives = 400/438 (91%)

Query: 1   MQKNLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLG 60
           MQ  L  LAQLAE+YSK++VVQGGYI+SI  VYYTVT LS+YVCLGDFVVH+GK SDNLG
Sbjct: 1   MQNKLARLAQLAENYSKSIVVQGGYINSIMPVYYTVTGLSKYVCLGDFVVHRGKYSDNLG 60

Query: 61  QVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISPSACWCGRVINALGKPIDGDDSLG 120
           QVIRI+ D++Y+CPVGI + I+LGDLVF  G FRISPS CWCGRV+NALGKPIDGD SL 
Sbjct: 61  QVIRIDHDVLYVCPVGIDKTITLGDLVFRQGPFRISPSECWCGRVLNALGKPIDGDFSLK 120

Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180
            G  SM+I+ K+P  MNRQRVEKGFKTGIRVIDIFTPLC+GQRIG+FAGSGIGKSTLLSM
Sbjct: 121 TGHFSMDIIGKIPSVMNRQRVEKGFKTGIRVIDIFTPLCYGQRIGIFAGSGIGKSTLLSM 180

Query: 181 FARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT 240
           FA+SDCFDKV+ISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTA T
Sbjct: 181 FAKSDCFDKVVISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAFT 240

Query: 241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS 300
           IAEYF SKGDNVLLILDSITRFAH+IREI+ NSGELPV RGYP SVFSELPRLLER GP 
Sbjct: 241 IAEYFCSKGDNVLLILDSITRFAHAIREISMNSGELPVTRGYPASVFSELPRLLERAGPR 300

Query: 301 EKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRL 360
           EKEKG+ITA+ISVLVDGDNHNDPIADSVRSILDGH+VL RSLAEEGRYPPVDPLASVSRL
Sbjct: 301 EKEKGSITAIISVLVDGDNHNDPIADSVRSILDGHVVLKRSLAEEGRYPPVDPLASVSRL 360

Query: 361 ADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYDFLKQS 420
           A KAWS+DE+KLV+SL +LIH+FEETRDIRLIGGYRPGVD+ LDKAV QVPIIYDFLKQS
Sbjct: 361 AYKAWSSDEEKLVASLKNLIHQFEETRDIRLIGGYRPGVDINLDKAVRQVPIIYDFLKQS 420

Query: 421 PSDLSSEDVFQEITKKLQ 438
           PSDL  +DVF EITKKLQ
Sbjct: 421 PSDLLLKDVFLEITKKLQ 438


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084860|ref|YP_002543389.1| H(+)-transporting ATP synthase [Agrobacterium radiobacter K84] Length = 462 Back     alignment and organism information
>gi|227820853|ref|YP_002824823.1| flagellum-specific ATP synthase [Sinorhizobium fredii NGR234] Length = 466 Back     alignment and organism information
>gi|15887903|ref|NP_353584.1| flagellum-specific ATP synthase [Agrobacterium tumefaciens str. C58] Length = 473 Back     alignment and organism information
>gi|325291944|ref|YP_004277808.1| flagellum-specific ATP synthase [Agrobacterium sp. H13-3] Length = 468 Back     alignment and organism information
>gi|209547923|ref|YP_002279840.1| flagellum-specific ATP synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 465 Back     alignment and organism information
>gi|15964410|ref|NP_384763.1| flagellum-specific ATP synthase [Sinorhizobium meliloti 1021] Length = 467 Back     alignment and organism information
>gi|2916791|emb|CAA11957.1| flagellar export apparatus protein [Sinorhizobium meliloti] Length = 467 Back     alignment and organism information
>gi|327193032|gb|EGE59944.1| H(+)-transporting ATP synthase, flagellum-specific protein [Rhizobium etli CNPAF512] Length = 464 Back     alignment and organism information
>gi|190890358|ref|YP_001976900.1| H(+)-transporting ATP synthase, flagellum-specific protein [Rhizobium etli CIAT 652] Length = 464 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target438 flagellum-specific ATP synthase [Candidatus Liberibacte
PRK06002450 PRK06002, fliI, flagellum-specific ATP synthase; Valida 0.0
TIGR03498418 TIGR03498, FliI_clade3, flagellar protein export ATPase 1e-164
TIGR03496411 TIGR03496, FliI_clade1, flagellar protein export ATPase 1e-149
PRK08472434 PRK08472, fliI, flagellum-specific ATP synthase; Valida 2e-94
PRK05922434 PRK05922, PRK05922, type III secretion system ATPase; V 1e-57
COG1157441 COG1157, FliI, Flagellar biosynthesis/type III secretor 1e-136
PRK08927442 PRK08927, fliI, flagellum-specific ATP synthase; Valida 1e-113
cd01136326 cd01136, ATPase_flagellum-secretory_path_III, Flagellum 1e-105
PRK06936439 PRK06936, PRK06936, type III secretion system ATPase; P 5e-88
PRK08972444 PRK08972, fliI, flagellum-specific ATP synthase; Valida 3e-82
PRK06315442 PRK06315, PRK06315, type III secretion system ATPase; P 6e-76
PRK07960455 PRK07960, fliI, flagellum-specific ATP synthase; Valida 3e-75
PRK08149428 PRK08149, PRK08149, ATP synthase SpaL; Validated 6e-74
COG1155588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit 8e-27
PRK04192586 PRK04192, PRK04192, V-type ATP synthase subunit A; Prov 4e-19
TIGR02546422 TIGR02546, III_secr_ATP, type III secretion apparatus H 1e-107
TIGR01026440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 1e-103
TIGR03497413 TIGR03497, FliI_clade2, flagellar protein export ATPase 1e-100
PRK07721438 PRK07721, fliI, flagellum-specific ATP synthase; Valida 6e-91
PRK06820440 PRK06820, PRK06820, type III secretion system ATPase; V 8e-90
PRK09099441 PRK09099, PRK09099, type III secretion system ATPase; P 5e-85
PRK05688451 PRK05688, fliI, flagellum-specific ATP synthase; Valida 6e-85
PRK07196434 PRK07196, fliI, flagellum-specific ATP synthase; Valida 8e-82
PRK07594433 PRK07594, PRK07594, type III secretion system ATPase Ss 4e-79
PRK06793432 PRK06793, fliI, flagellum-specific ATP synthase; Valida 3e-60
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, 1e-79
cd01134369 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic 2e-26
KOG1352618 KOG1352, KOG1352, KOG1352, Vacuolar H+-ATPase V1 sector 2e-21
TIGR01042591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subu 3e-19
PRK07165507 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Va 1e-17
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 1e-13
PRK12608380 PRK12608, PRK12608, transcription termination factor Rh 2e-12
TIGR00767415 TIGR00767, rho, transcription termination factor Rho 8e-10
PRK09376416 PRK09376, rho, transcription termination factor Rho; Pr 1e-08
smart00382148 smart00382, AAA, ATPases associated with a variety of c 5e-04
COG0055468 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [En 3e-44
PRK12597461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Pro 1e-43
TIGR01039461 TIGR01039, atpD, ATP synthase, F1 beta subunit 3e-41
KOG1350521 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta 3e-37
TIGR01041458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B sub 5e-37
TIGR03305449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 s 1e-36
PRK13343502 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Pr 2e-32
TIGR00962501 TIGR00962, atpA, proton translocating ATP synthase, F1 3e-29
TIGR03324497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 su 8e-27
KOG1351489 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector 1e-25
TIGR01040466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subu 1e-23
TIGR01043578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A sub 1e-20
PRK09281502 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Va 1e-19
PTZ00185574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional 2e-19
cd01133274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, 6e-44
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catal 1e-39
PRK09280463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Val 2e-39
CHL00060494 CHL00060, atpB, ATP synthase CF1 beta subunit 9e-30
cd01132274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, centra 4e-27
COG1156463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit 3e-42
COG0056504 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [E 2e-37
PRK04196460 PRK04196, PRK04196, V-type ATP synthase subunit B; Prov 1e-35
CHL00059485 CHL00059, atpA, ATP synthase CF1 alpha subunit 8e-20
PRK02118436 PRK02118, PRK02118, V-type ATP synthase subunit B; Prov 1e-29
PRK146981017 PRK14698, PRK14698, V-type ATP synthase subunit A; Prov 2e-16
cd01128249 cd01128, rho_factor, Transcription termination factor r 1e-14
COG1158422 COG1158, Rho, Transcription termination factor [Transcr 2e-13
KOG1353340 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alph 2e-05
>gnl|CDD|168339 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|163292 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|31351 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|181583 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|30002 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181253 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|31349 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179776 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|162913 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|162162 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|132536 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|30000 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>gnl|CDD|36566 KOG1352, KOG1352, KOG1352, Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162171 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>gnl|CDD|180863 PRK07165, PRK07165, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|183622 PRK12608, PRK12608, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|162030 TIGR00767, rho, transcription termination factor Rho Back     alignment and domain information
>gnl|CDD|181809 PRK09376, rho, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|30404 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|130111 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|36564 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162170 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|162134 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|36565 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162169 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|181753 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|29999 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|30001 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|181752 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|177000 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information
>gnl|CDD|29998 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|31350 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30405 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179779 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|29994 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>gnl|CDD|31352 COG1158, Rho, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|36567 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 438 flagellum-specific ATP synthase [Candidatus Liberibacte
TIGR02545439 ATP_syn_fliI flagellar protein export ATPase FliI; Inte 100.0
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 100.0
TIGR01026455 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 100.0
COG1157441 FliI Flagellar biosynthesis/type III secretory pathway 100.0
PRK06002450 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08972440 fliI flagellum-specific ATP synthase; Validated 100.0
PRK05688451 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08927441 fliI flagellum-specific ATP synthase; Validated 100.0
PRK06936439 type III secretion system ATPase; Provisional 100.0
PRK06315442 type III secretion system ATPase; Provisional 100.0
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. Membe 100.0
PRK07960455 fliI flagellum-specific ATP synthase; Validated 100.0
PRK09099441 type III secretion system ATPase; Provisional 100.0
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 100.0
PRK07721435 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 100.0
PRK07594433 type III secretion system ATPase; Validated 100.0
PRK06820445 type III secretion system ATPase; Validated 100.0
PRK08472435 fliI flagellum-specific ATP synthase; Validated 100.0
PRK08149427 ATP synthase SpaL; Validated 100.0
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. Membe 100.0
PRK06793432 fliI flagellum-specific ATP synthase; Validated 100.0
PRK05922434 type III secretion system ATPase; Validated 100.0
TIGR00962520 atpA ATP synthase F1, alpha subunit; InterPro: IPR00529 100.0
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. 100.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 100.0
CHL00059501 atpA ATP synthase CF1 alpha subunit 100.0
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 100.0
PRK04196460 V-type ATP synthase subunit B; Provisional 100.0
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 100.0
PRK09280466 F0F1 ATP synthase subunit beta; Validated 100.0
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 100.0
CHL00060480 atpB ATP synthase CF1 beta subunit 100.0
PRK02118432 V-type ATP synthase subunit B; Provisional 100.0
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 100.0
COG0056504 AtpA F0F1-type ATP synthase, alpha subunit [Energy prod 100.0
PRK04192585 V-type ATP synthase subunit A; Provisional 100.0
COG1156463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy 100.0
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy produ 100.0
TIGR01043584 ATP_syn_A_arch ATP synthase archaeal, A subunit; InterP 100.0
KOG1351489 consensus 100.0
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy 100.0
KOG1350521 consensus 100.0
KOG1352618 consensus 100.0
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit; InterP 100.0
TIGR01040464 V-ATPase_V1_B V-type ATPase, B subunit; InterPro: IPR00 100.0
TIGR01039460 atpD ATP synthase F1, beta subunit; InterPro: IPR005722 100.0
TIGR01042596 V-ATPase_V1_A V-type ATPase, A subunit; InterPro: IPR00 100.0
KOG1353340 consensus 100.0
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-specific 100.0
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 100.0
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central domain. 100.0
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 100.0
PTZ00185574 ATPase alpha subunit; Provisional 100.0
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A. 100.0
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 100.0
COG1158422 Rho Transcription termination factor [Transcription] 100.0
PRK09302501 circadian clock protein KaiC; Reviewed 98.29
PRK06067241 flagellar accessory protein FlaH; Validated 98.27
pfam06745231 KaiC KaiC. This family represents a conserved region wi 98.24
PRK04328250 hypothetical protein; Provisional 98.05
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 98.05
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 97.92
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.66
cd01128249 rho_factor Transcription termination factor rho is a ba 100.0
PRK12678667 transcription termination factor Rho; Provisional 100.0
TIGR00767420 rho transcription termination factor Rho; InterPro: IPR 99.81
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 95.91
PRK12608379 transcription termination factor Rho; Provisional 100.0
PRK09376416 rho transcription termination factor Rho; Provisional 100.0
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 99.94
smart00382148 AAA ATPases associated with a variety of cellular activ 98.04
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.59
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.13
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 96.58
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 95.14
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.0
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 94.69
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 94.43
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 94.21
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 93.36
PRK06217185 hypothetical protein; Validated 93.21
PRK09700510 D-allose transporter ATP-binding protein; Provisional 92.87
pfam0287469 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barr 98.04
pfam00306110 ATP-synt_ab_C ATP synthase alpha/beta chain, C terminal 97.94
PRK09302 501 circadian clock protein KaiC; Reviewed 97.86
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 97.58
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 97.39
PRK13341 726 recombination factor protein RarA/unknown domain fusion 97.37
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 97.28
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.14
PRK13342 417 recombination factor protein RarA; Reviewed 97.06
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 96.97
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 96.96
pfam00931285 NB-ARC NB-ARC domain. 96.75
PRK09354350 recA recombinase A; Provisional 96.68
PRK04301318 radA DNA repair and recombination protein RadA; Validat 96.62
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 96.54
PRK11823 454 DNA repair protein RadA; Provisional 96.44
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 96.42
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 96.3
KOG4658 889 consensus 95.86
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 95.34
KOG1969 877 consensus 95.19
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 95.18
PRK04841 903 transcriptional regulator MalT; Provisional 95.13
PRK07952242 DNA replication protein DnaC; Validated 95.09
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 95.01
COG4172534 ABC-type uncharacterized transport system, duplicated A 94.91
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 94.89
PRK05541176 adenylylsulfate kinase; Provisional 94.68
COG4619223 ABC-type uncharacterized transport system, ATPase compo 94.57
KOG2028 554 consensus 94.5
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.24
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 94.24
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 94.13
CHL00195491 ycf46 Ycf46; Provisional 94.12
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 94.11
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.06
KOG0735 952 consensus 94.05
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 94.05
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 93.44
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 93.41
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 93.08
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 93.03
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 92.83
COG4136213 ABC-type uncharacterized transport system, ATPase compo 92.81
KOG1433326 consensus 92.66
PRK03846198 adenylylsulfate kinase; Provisional 92.66
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 92.48
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 92.46
pfam00625182 Guanylate_kin Guanylate kinase. 92.42
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 92.2
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 92.03
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 92.02
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 91.92
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 91.84
PRK00889175 adenylylsulfate kinase; Provisional 91.75
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 91.25
PRK00300208 gmk guanylate kinase; Provisional 91.16
PTZ00133182 ADP-ribosylation factor; Provisional 90.87
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 90.85
KOG0737386 consensus 90.85
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 90.68
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 90.65
TIGR00067262 glut_race glutamate racemase; InterPro: IPR004391 Gluta 90.41
PRK09435325 arginine/ornithine transport system ATPase; Provisional 90.04
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.79
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.52
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.28
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 96.27
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 96.15
PRK10636638 putative ABC transporter ATP-binding protein; Provision 96.04
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.03
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.03
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 95.92
PRK03992390 proteasome-activating nucleotidase; Provisional 95.86
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 95.81
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 95.78
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 95.77
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.75
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.73
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.71
PRK11147632 ABC transporter ATPase component; Reviewed 95.71
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 95.68
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 95.67
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 95.66
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 95.66
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 95.65
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.64
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.63
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.62
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.61
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.61
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.58
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.57
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.51
PRK10744257 phosphate transporter subunit; Provisional 95.51
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.5
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 95.49
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 95.48
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 95.48
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 95.47
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.47
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.46
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.46
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 95.45
COG4987573 CydC ABC-type transport system involved in cytochrome b 95.45
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.45
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 95.43
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.43
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.42
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.42
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.39
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.39
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 95.37
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 95.36
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.34
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.33
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.32
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.32
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.31
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 95.3
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.29
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.27
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.27
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.25
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.25
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 95.24
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 95.23
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 95.21
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 95.21
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 95.2
cd03234226 ABCG_White The White subfamily represents ABC transport 95.19
PRK08118167 topology modulation protein; Reviewed 95.19
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 95.19
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 95.18
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.18
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.17
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 95.16
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 95.16
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.14
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 95.13
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.13
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 95.13
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.12
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.11
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.11
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.1
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.1
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 95.09
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.09
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.08
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.08
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.07
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.06
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.05
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.01
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 95.01
COG3839338 MalK ABC-type sugar transport systems, ATPase component 95.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.99
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.99
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 94.99
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 94.98
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.96
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 94.96
PRK09984262 phosphonate/organophosphate ester transporter subunit; 94.91
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.9
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.9
PRK10790593 putative multidrug transporter membrane\ATP-binding com 94.89
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.89
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 94.86
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.86
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 94.84
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 94.83
PRK13542224 consensus 94.83
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 94.82
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 94.8
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 94.8
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 94.77
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.74
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 94.74
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 94.73
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 94.72
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 94.72
COG0488 530 Uup ATPase components of ABC transporters with duplicat 94.69
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 94.69
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 94.68
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.64
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 94.63
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 94.62
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.62
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 94.62
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 94.6
PRK03695245 vitamin B12-transporter ATPase; Provisional 94.6
pfam00004131 AAA ATPase family associated with various cellular acti 94.6
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 94.6
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.58
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.57
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 94.56
KOG0057591 consensus 94.52
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 94.5
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 94.49
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 94.49
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 94.47
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 94.47
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 94.43
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 94.43
COG4988559 CydD ABC-type transport system involved in cytochrome b 94.41
PRK10908222 cell division protein FtsE; Provisional 94.39
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.37
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 94.36
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 94.35
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 94.31
COG1127263 Ttg2A ABC-type transport system involved in resistance 94.3
PRK12422455 chromosomal replication initiation protein; Provisional 94.29
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 94.28
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.27
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 94.27
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 94.26
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 94.26
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 94.25
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 94.21
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 94.2
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 94.2
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.18
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 94.15
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 94.12
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 94.08
COG1123539 ATPase components of various ABC-type transport systems 94.06
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 94.04
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 93.97
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 93.92
PRK13409 590 putative ATPase RIL; Provisional 93.91
PRK13544208 consensus 93.9
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 93.9
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 93.88
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.87
COG4181228 Predicted ABC-type transport system involved in lysopho 93.87
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 93.81
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 93.75
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 93.73
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 93.71
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.69
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 93.68
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.67
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 93.64
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 93.61
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 93.57
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 93.55
COG4167267 SapF ABC-type antimicrobial peptide transport system, A 93.54
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 93.54
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 93.53
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 93.52
PRK05595444 replicative DNA helicase; Provisional 93.44
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 93.43
COG4525259 TauB ABC-type taurine transport system, ATPase componen 93.43
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 93.43
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 93.4
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 93.37
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 93.34
pfam03193161 DUF258 Protein of unknown function, DUF258. 93.33
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 93.29
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 93.25
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 93.19
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 93.19
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 93.17
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 93.15
PRK13536306 nodulation factor exporter subunit NodI; Provisional 93.08
COG1162301 Predicted GTPases [General function prediction only] 93.01
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 93.0
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 93.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 92.97
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 92.93
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 92.88
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 92.84
PRK08084235 DNA replication initiation factor; Provisional 92.79
PRK00098298 ribosome-associated GTPase; Reviewed 92.76
PRK08082453 consensus 92.76
PRK08506473 replicative DNA helicase; Provisional 92.73
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 92.72
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 92.68
COG4178604 ABC-type uncharacterized transport system, permease and 92.65
PRK08006471 replicative DNA helicase; Provisional 92.65
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 92.63
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 92.63
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 92.57
PRK05748448 replicative DNA helicase; Provisional 92.57
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 92.55
KOG0055 1228 consensus 92.48
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 92.42
COG1135339 AbcC ABC-type metal ion transport system, ATPase compon 92.39
PRK01889353 ribosome-associated GTPase; Reviewed 92.38
PRK05642234 DNA replication initiation factor; Validated 92.33
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 92.33
PRK12288344 ribosome-associated GTPase; Reviewed 92.33
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 92.29
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 92.28
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 92.24
PRK13549513 xylose transporter ATP-binding subunit; Provisional 92.23
PRK08233182 hypothetical protein; Provisional 92.1
KOG0062 582 consensus 92.07
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 92.06
PRK13873815 conjugal transfer ATPase TrbE; Provisional 91.84
PRK08840464 replicative DNA helicase; Provisional 91.83
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 91.8
PRK06749428 replicative DNA helicase; Provisional 91.7
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 91.67
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 91.66
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 91.61
PRK07263453 consensus 91.59
COG4586325 ABC-type uncharacterized transport system, ATPase compo 91.45
PRK10762501 D-ribose transporter ATP binding protein; Provisional 91.4
PRK09165484 replicative DNA helicase; Provisional 91.37
PRK00149447 dnaA chromosomal replication initiation protein; Review 91.27
PRK09700510 D-allose transporter ATP-binding protein; Provisional 91.14
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 91.11
COG1119257 ModF ABC-type molybdenum transport system, ATPase compo 91.1
PRK13830818 conjugal transfer protein TrbE; Provisional 91.0
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 91.0
COG4148352 ModC ABC-type molybdate transport system, ATPase compon 90.99
PRK06904472 replicative DNA helicase; Validated 90.93
PTZ00243 1560 ABC transporter; Provisional 90.91
pfam07726131 AAA_3 ATPase family associated with various cellular ac 90.89
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 90.83
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 90.77
PRK13891852 conjugal transfer protein TrbE; Provisional 90.76
COG1100219 GTPase SAR1 and related small G proteins [General funct 90.74
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 90.7
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 90.63
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 90.61
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 90.56
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 90.45
PRK08760476 replicative DNA helicase; Provisional 90.42
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 90.38
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 90.33
PRK05480209 uridine kinase; Provisional 90.3
PRK08694468 consensus 90.25
COG0410237 LivF ABC-type branched-chain amino acid transport syste 90.2
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 90.19
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 90.16
PRK07004460 replicative DNA helicase; Provisional 90.14
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 90.14
PRK07429331 phosphoribulokinase; Provisional 90.13
COG1155588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy 96.72
PRK10762501 D-ribose transporter ATP binding protein; Provisional 93.45
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 96.47
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 93.56
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 93.45
KOG0743457 consensus 95.98
PTZ00035350 Rad51; Provisional 95.74
PRK10636638 putative ABC transporter ATP-binding protein; Provision 95.56
KOG0055 1228 consensus 91.89
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.53
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 94.73
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 90.39
PRK11147632 ABC transporter ATPase component; Reviewed 95.38
COG1123539 ATPase components of various ABC-type transport systems 94.01
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 92.67
PRK07261171 topology modulation protein; Provisional 95.03
PRK04195403 replication factor C large subunit; Provisional 94.68
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 94.15
TIGR01184230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 93.98
KOG0727408 consensus 93.7
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 93.36
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 93.32
TIGR012711534 CFTR_protein cystic fibrosis transmembrane conductor re 92.62
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 92.36
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 94.79
COG0488530 Uup ATPase components of ABC transporters with duplicat 94.1
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 91.49
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 94.72
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 94.72
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 94.4
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 94.16
PRK13549513 xylose transporter ATP-binding subunit; Provisional 93.85
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 94.42
PRK09519790 recA recombinase A; Reviewed 93.48
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 93.39
PRK13409 590 putative ATPase RIL; Provisional 92.96
PRK12289351 ribosome-associated GTPase; Reviewed 92.63
KOG0060659 consensus 92.52
>TIGR02545 ATP_syn_fliI flagellar protein export ATPase FliI; InterPro: IPR013379 FliI proteins are involved in bacterial flagellum systems, acting to drive protein export for flagellar biosynthesis Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase; InterPro: IPR013380 Proteins in this entry are found in a variety of bacteria, and are predicted to be ATPases involved in type III secretion systems Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 Proteins in this entry show extensive homology to the ATP synthase F1 beta subunit, and are involved in type III protein secretion Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information