254780685

254780685

flagellar basal body rod protein FlgF

GeneID in NCBI database:8209689Locus tag:CLIBASIA_02860
Protein GI in NCBI database:254780685Protein Accession:YP_003065098.1
Gene range:+(582061, 582792)Protein Length:243aa
Gene description:flagellar basal body rod protein FlgF
COG prediction:[N] Flagellar basal body rod protein
KEGG prediction:flgF; flagellar basal body rod protein FlgF; K02391 flagellar basal-body rod protein FlgF
SEED prediction:Flagellar basal-body rod protein flgF
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS
ccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccEEEEEEEEEEEEccccEEEccccEEEEEEccEEEEEEccccEEEEEEcccEEcccccEEcccccEEccccccccEEcccccccccccccccccccccEEEEEEEEEEccHHHHcccccccccccccccccccccccEEEEcEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cccHHHHHcccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccEEEEEEEEEcccccccccccccEEEEcccEEEEEcccccEEEccccEEEccccEEEEccccEEccccccccEEEcccccEEEEccccEEEEccEEEEEEEEEEEcccccccccccccccccccccccccccccEEEEcEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MQTSFNIGLAAQLALEQRLSTVadnmsntdtvgFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFIstgteldfalegdawfalesprgiiltrdgrfkvtddgslvsasgkypvldmasvpiqipqkdeifnvgekgeisqkGKVIATMGLYSVdmsqgfvrrensgispnipptpledlsgvtvkrgfledsnansMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS
MQTSFNIGLAAQLALEQRLSTVadnmsntdtvgfRTIKVKFSEVVGaikndidqKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEifnvgekgeisqkgkVIATMGLYSVDMSQGFVRRENSgispnipptpledlsgVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS
MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS
**TSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSE***********************SKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNI****LEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNI**
MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS
*QTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNI**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS
MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS
MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRNIAS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
254780525 421 flagellar hook protein FlgE [Candidatus Liberibact 6e-11
254780378262 flagellar basal body rod protein FlgG [Candidatus 7e-10
>gi|254780525|ref|YP_003064938.1| flagellar hook protein FlgE [Candidatus Liberibacter asiaticus str. psy62] Length = 421 Back     alignment
 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 71/137 (51%), Gaps = 15/137 (10%)

Query: 4   SFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGK 63
           S    ++   A   R+S V+DN++N DTVG++   + FS +V    ++     S+V+ G 
Sbjct: 6   SMKTAMSGMDAQSNRVSAVSDNIANVDTVGYKRTAIAFSSLVFPSTSN-----SYVSGGL 60

Query: 64  EYLSK----EVGSFISTGTELDFALEGDAWFALESPRGI-ILTRDGRFKVTDDGSLVSAS 118
           E  +K    E GS + T +  D A++G  +F ++    +  LTR G F + ++G L + +
Sbjct: 61  EISTKDMISEQGSLMHTASNTDLAIQGKGFFIVKGRDNVNCLTRAGDFHINNEGFLENVA 120

Query: 119 G----KYPVLDMASVPI 131
           G     YP L  AS P+
Sbjct: 121 GGVLLGYP-LKNASAPL 136

>gi|254780378|ref|YP_003064791.1| flagellar basal body rod protein FlgG [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 55.8 bits (133), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 83/169 (49%), Gaps = 15/169 (8%)

Query: 71  GSFISTGTELDFALEGDAWFALESP-RGIILTRDGRFKVTDDGSLVSASGK--YP--VLD 125
           G  + TG  LD AL G  WF +E+P + ++ TR G F +   G LV+A G    P  V+ 
Sbjct: 85  GEVVHTGNNLDLALVGRGWFQVETPDKTVMYTRAGSFNIDSKGQLVTADGNTLVPGIVIP 144

Query: 126 MASVPIQIPQKDEIFNV-GEKGEISQKGKV-----IATMGLYSVDMSQGFVRRENSGISP 179
             +  I++ +  +I  V G+  +    G++     I   GL ++      + R +    P
Sbjct: 145 EETREIKVSRSGQILAVTGKNSDFQPVGQLLIANFINEAGLRNI--GDNLLARTSVSGDP 202

Query: 180 NIPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLID 228
            I   P +D+    VK+G+LE SN +++ E+ +MI   + +   + +I+
Sbjct: 203 -IISNP-DDIGFAHVKQGYLEASNVDAVKEISEMISAQRAYEMNSKVIE 249

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
315121852243 flagellar basal body rod protein FlgF [Candidatus Liber 1 1e-106
222084859244 flagellar basal-body rod protein [Agrobacterium radioba 1 2e-58
218461633244 flagellar basal body rod protein FlgF [Rhizobium etli K 1 4e-58
325291945244 flagellar basal body rod protein FlgF [Agrobacterium sp 1 8e-58
218673219244 flagellar basal body rod protein FlgF [Rhizobium etli G 1 3e-57
241203100244 flagellar basal body rod protein FlgF [Rhizobium legumi 1 7e-57
327193031244 flagellar basal-body rod protein [Rhizobium etli CNPAF5 1 1e-56
190890357244 flagellar basal-body rod protein [Rhizobium etli CIAT 6 1 1e-56
116250476244 flagellar basal body rod protein FlgF [Rhizobium legumi 1 2e-56
86356306244 flagellar basal body rod protein FlgF [Rhizobium etli C 1 4e-56
>gi|315121852|ref|YP_004062341.1| flagellar basal body rod protein FlgF [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 243 Back     alignment and organism information
 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/243 (74%), Positives = 214/243 (88%)

Query: 1   MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVA 60
           MQ+SFNIGL+AQ+ALE+RLSTVADN+SN++T GFR IKVKFSEV+ +IKNDIDQKISFVA
Sbjct: 1   MQSSFNIGLSAQIALEKRLSTVADNISNSNTSGFRAIKVKFSEVINSIKNDIDQKISFVA 60

Query: 61  SGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGK 120
            G EYLSK+ GS  +TG ELDFALEGDAWF+L++PRGIILTRDGRFK+ +DG+L+S+SG+
Sbjct: 61  QGNEYLSKQNGSLTNTGGELDFALEGDAWFSLQTPRGIILTRDGRFKIREDGTLISSSGR 120

Query: 121 YPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPN 180
           YPVLDM   PI IP KDE F VGE+GEISQKGK IA MG YS D+S+GFVRRENSGI PN
Sbjct: 121 YPVLDMEGAPIHIPHKDEAFEVGEEGEISQKGKKIAAMGFYSADLSKGFVRRENSGIFPN 180

Query: 181 IPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRN 240
           IPP P+ D S +TVKRG++EDSNANSMYEMGQMIHLTQKFNSIT LID+++KS LEAI+N
Sbjct: 181 IPPVPVLDPSDITVKRGYIEDSNANSMYEMGQMIHLTQKFNSITELIDDSDKSFLEAIKN 240

Query: 241 IAS 243
           + S
Sbjct: 241 LVS 243


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084859|ref|YP_002543388.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84] Length = 244 Back     alignment and organism information
>gi|218461633|ref|ZP_03501724.1| flagellar basal body rod protein FlgF [Rhizobium etli Kim 5] Length = 244 Back     alignment and organism information
>gi|325291945|ref|YP_004277809.1| flagellar basal body rod protein FlgF [Agrobacterium sp. H13-3] Length = 244 Back     alignment and organism information
>gi|218673219|ref|ZP_03522888.1| flagellar basal body rod protein FlgF [Rhizobium etli GR56] Length = 244 Back     alignment and organism information
>gi|241203100|ref|YP_002974196.1| flagellar basal body rod protein FlgF [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 244 Back     alignment and organism information
>gi|327193031|gb|EGE59943.1| flagellar basal-body rod protein [Rhizobium etli CNPAF512] Length = 244 Back     alignment and organism information
>gi|190890357|ref|YP_001976899.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652] Length = 244 Back     alignment and organism information
>gi|116250476|ref|YP_766314.1| flagellar basal body rod protein FlgF [Rhizobium leguminosarum bv. viciae 3841] Length = 244 Back     alignment and organism information
>gi|86356306|ref|YP_468198.1| flagellar basal body rod protein FlgF [Rhizobium etli CFN 42] Length = 244 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
PRK12642241 PRK12642, flgF, flagellar basal body rod protein FlgF; 3e-67
TIGR03506231 TIGR03506, FlgEFG_subfam, fagellar hook-basal body prot 4e-34
PRK12690238 PRK12690, flgF, flagellar basal body rod protein FlgF; 6e-29
PRK12689253 PRK12689, flgF, flagellar basal body rod protein FlgF; 2e-26
PRK12640246 PRK12640, flgF, flagellar basal body rod protein FlgF; 4e-18
TIGR02488259 TIGR02488, flgG_G_neg, flagellar basal-body rod protein 1e-16
PRK12636263 PRK12636, flgG, flagellar basal body rod protein FlgG; 7e-16
PRK12693261 PRK12693, flgG, flagellar basal body rod protein FlgG; 8e-15
COG4787251 COG4787, FlgF, Flagellar basal body rod protein [Cell m 1e-13
PRK12691262 PRK12691, flgG, flagellar basal body rod protein FlgG; 1e-13
PRK12817260 PRK12817, flgG, flagellar basal body rod protein FlgG; 2e-13
PRK12816264 PRK12816, flgG, flagellar basal body rod protein FlgG; 2e-12
PRK12694260 PRK12694, flgG, flagellar basal body rod protein FlgG; 4e-12
PRK12818256 PRK12818, flgG, flagellar basal body rod protein FlgG; 3e-10
PRK12641252 PRK12641, flgF, flagellar basal body rod protein FlgF; 8e-10
PRK12819257 PRK12819, flgG, flagellar basal body rod protein FlgG; 8e-07
COG4786265 COG4786, FlgG, Flagellar basal body rod protein [Cell m 2e-34
PRK05682 407 PRK05682, flgE, flagellar hook protein FlgE; Validated 1e-12
COG1749 423 COG1749, FlgE, Flagellar hook protein FlgE [Cell motili 4e-12
PRK06803 402 PRK06803, flgE, flagellar hook protein FlgE; Validated 7e-10
PRK12692262 PRK12692, flgG, flagellar basal body rod protein FlgG; 3e-07
PRK12637 473 PRK12637, flgE, flagellar hook protein FlgE; Provisiona 8e-07
PRK05841 603 PRK05841, flgE, flagellar hook protein FlgE; Validated 3e-05
TIGR02489 719 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, e 6e-04
TIGR0249089 TIGR02490, flgF, flagellar basal-body rod protein FlgF 1e-10
>gnl|CDD|183643 PRK12642, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins Back     alignment and domain information
>gnl|CDD|183685 PRK12690, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183684 PRK12689, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183642 PRK12640, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|131541 TIGR02488, flgG_G_neg, flagellar basal-body rod protein FlgG, Gram-negative bacteria Back     alignment and domain information
>gnl|CDD|183640 PRK12636, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|183687 PRK12693, flgG, flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>gnl|CDD|34398 COG4787, FlgF, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183686 PRK12691, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183767 PRK12817, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183766 PRK12816, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183688 PRK12694, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183768 PRK12818, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|105809 PRK12641, flgF, flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>gnl|CDD|183769 PRK12819, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|34397 COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|180198 PRK05682, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|31935 COG1749, FlgE, Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|180703 PRK06803, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|139158 PRK12692, flgG, flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>gnl|CDD|183641 PRK12637, flgE, flagellar hook protein FlgE; Provisional Back     alignment and domain information
>gnl|CDD|180282 PRK05841, flgE, flagellar hook protein FlgE; Validated Back     alignment and domain information
>gnl|CDD|131542 TIGR02489, flgE_epsilon, flagellar hook protein FlgE, epsilon proteobacterial Back     alignment and domain information
>gnl|CDD|162884 TIGR02490, flgF, flagellar basal-body rod protein FlgF Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 243 flagellar basal body rod protein FlgF [Candidatus Liber
TIGR02488263 flgG_G_neg flagellar basal-body rod protein FlgG; Inter 100.0
PRK12642241 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK12690237 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
COG4786265 FlgG Flagellar basal body rod protein [Cell motility an 100.0
PRK12689253 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK12636263 flgG flagellar basal body rod protein FlgG; Provisional 100.0
PRK12693261 flgG flagellar basal body rod protein FlgG; Provisional 100.0
PRK12691262 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12640246 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK12694260 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12818255 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12816264 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12817261 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
TIGR02490254 flgF flagellar basal-body rod protein FlgF; InterPro: I 100.0
PRK12819257 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12692262 flgG flagellar basal body rod protein FlgG; Reviewed 100.0
PRK12641252 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
TIGR03506231 FlgEFG_subfam fagellar hook-basal body proteins. This m 100.0
PRK05682414 flgE flagellar hook protein FlgE; Validated 100.0
PRK06803398 flgE flagellar hook protein FlgE; Validated 100.0
PRK12637473 flgE flagellar hook protein FlgE; Provisional 100.0
COG4787251 FlgF Flagellar basal body rod protein [Cell motility an 100.0
COG1749423 FlgE Flagellar hook protein FlgE [Cell motility and sec 100.0
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 99.78
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 99.73
PRK08425 716 flgE flagellar hook protein FlgE; Validated 100.0
PRK05841 605 flgE flagellar hook protein FlgE; Validated 100.0
TIGR02489 877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 100.0
PRK12643209 flgF flagellar basal body rod protein FlgF; Reviewed 100.0
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 99.79
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 99.75
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 99.74
PRK07739500 flgK flagellar hook-associated protein FlgK; Validated 99.72
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 99.72
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 99.7
PRK12631138 flgC flagellar basal body rod protein FlgC; Provisional 99.69
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 99.68
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 99.67
PRK07521482 flgK flagellar hook-associated protein FlgK; Validated 99.5
PRK07191456 flgK flagellar hook-associated protein FlgK; Validated 99.4
PRK06799431 flgK flagellar hook-associated protein FlgK; Validated 99.39
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 99.12
pfam0642939 DUF1078 Domain of unknown function (DUF1078). This fami 98.83
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 98.76
PRK08471612 flgK flagellar hook-associated protein FlgK; Validated 98.74
PRK08871626 flgK flagellar hook-associated protein FlgK; Validated 98.66
PRK12714624 flgK flagellar hook-associated protein FlgK; Provisiona 98.66
PRK12715649 flgK flagellar hook-associated protein FlgK; Provisiona 98.65
PRK06665628 flgK flagellar hook-associated protein FlgK; Validated 98.65
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 98.61
PRK08147547 flgK flagellar hook-associated protein FlgK; Validated 98.58
PRK06945649 flgK flagellar hook-associated protein FlgK; Validated 98.53
PRK05683676 flgK flagellar hook-associated protein FlgK; Validated 98.53
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 98.42
COG1256552 FlgK Flagellar hook-associated protein [Cell motility a 98.38
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 93.03
TIGR02489877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 99.52
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 99.29
PRK12619130 flgB flagellar basal body rod protein FlgB; Provisional 98.93
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 98.91
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 98.91
PRK12620132 flgB flagellar basal body rod protein FlgB; Provisional 98.83
PRK12621136 flgB flagellar basal body rod protein FlgB; Provisional 98.83
PRK06797135 flgB flagellar basal body rod protein FlgB; Reviewed 98.83
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 98.82
PRK12625132 flgB flagellar basal body rod protein FlgB; Provisional 98.8
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 98.78
PRK12685116 flgB flagellar basal body rod protein FlgB; Reviewed 98.76
PRK07182148 flgB flagellar basal body rod protein FlgB; Reviewed 98.75
pfam0046031 Flg_bb_rod Flagella basal body rod protein. 98.69
PRK12626162 flgB flagellar basal body rod protein FlgB; Provisional 98.67
PRK06665 628 flgK flagellar hook-associated protein FlgK; Validated 98.55
TIGR02492 495 flgK_ends flagellar hook-associated protein FlgK; Inter 98.41
PRK05683 676 flgK flagellar hook-associated protein FlgK; Validated 98.39
PRK12714 624 flgK flagellar hook-associated protein FlgK; Provisiona 98.33
PRK08147 547 flgK flagellar hook-associated protein FlgK; Validated 98.3
PRK12715 649 flgK flagellar hook-associated protein FlgK; Provisiona 98.3
PRK08871 626 flgK flagellar hook-associated protein FlgK; Validated 98.28
PRK06945 649 flgK flagellar hook-associated protein FlgK; Validated 98.28
PRK08471 612 flgK flagellar hook-associated protein FlgK; Validated 98.24
COG1256 552 FlgK Flagellar hook-associated protein [Cell motility a 98.1
TIGR01396134 FlgB flagellar basal-body rod protein FlgB; InterPro: I 96.75
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 94.21
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 93.19
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG; InterPro: IPR012834 This family consists of the FlgG protein of the flagellar apparatus in the proteobacteria and spirochetes Back     alignment and domain information
>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12640 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>TIGR02490 flgF flagellar basal-body rod protein FlgF; InterPro: IPR012836 Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria Back     alignment and domain information
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins Back     alignment and domain information
>PRK05682 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK06803 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information
>PRK12643 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>pfam06429 DUF1078 Domain of unknown function (DUF1078) Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>pfam00460 Flg_bb_rod Flagella basal body rod protein Back     alignment and domain information
>PRK12626 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>TIGR01396 FlgB flagellar basal-body rod protein FlgB; InterPro: IPR006300 Many bacterial species swim actively by means of flagella Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
3a69_A 402 Atomic Model Of The Bacterial Flagellar Hook Based 8e-12
3a69_A402 Atomic Model Of The Bacterial Flagellar Hook Based 2e-11
>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On Docking An X-Ray Derived Structure And Terminal Two Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem Map Length = 402 Back     alignment and structure
 Score = 74.9 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 71/195 (36%), Gaps = 6/195 (3%)

Query: 4   SFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGK 63
           SF+  ++   A    L  + +N++N+ T GF++    F+++         +    V    
Sbjct: 1   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFA-----GSKVGLGVKVAG 55

Query: 64  EYLSKEVGSFISTGTELDFALEGDAWFA-LESPRGIILTRDGRFKVTDDGSLVSASGKYP 122
                  G+  +TG  LD A+  + +F  ++S   +  +R+G+FK+ ++ +LV+  G   
Sbjct: 56  ITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQL 115

Query: 123 VLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIP 182
               A+      Q+                K   T  +     S   V  +      +  
Sbjct: 116 TGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDAD 175

Query: 183 PTPLEDLSGVTVKRG 197
               +    V   +G
Sbjct: 176 SYNKKGTVTVYDSQG 190


>gi|281306984|pdb|3A69|A Chain A, Atomic Model Of The Bacterial Flagellar Hook Based On Docking An X-Ray Derived Structure And Terminal Two Alpha- Helices Into An 7.1 Angstrom Resolution Cryoem Map Length = 402 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
3a69_A 402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 6e-12
1wlg_A 299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 1e-04
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Length = 402 Back     alignment and structure
 Score = 66.2 bits (160), Expect = 6e-12
 Identities = 36/205 (17%), Positives = 77/205 (37%), Gaps = 11/205 (5%)

Query: 4   SFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGK 63
           SF+  ++   A    L  + +N++N+ T GF++    F+++    K  +  K++ +    
Sbjct: 1   SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGI---- 56

Query: 64  EYLSKEVGSFISTGTELDFALEGDAWFALESPRG-IILTRDGRFKVTDDGSLVSASGKYP 122
                  G+  +TG  LD A+  + +F L    G +  +R+G+FK+ ++ +LV+  G   
Sbjct: 57  -TQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQL 115

Query: 123 VLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIP 182
               A           I        I+    ++A     +  M       +         
Sbjct: 116 TGYPA-----TGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFS 170

Query: 183 PTPLEDLSGVTVKRGFLEDSNANSM 207
            +  +  +       +    NA+ M
Sbjct: 171 VSDADSYNKKGTVTVYDSQGNAHDM 195


>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 100.0
1wlg_A299 Flagellar HOOK protein FLGE; EAR-& motif, structural pr 99.91
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=100.00  E-value=0  Score=310.10  Aligned_cols=230  Identities=20%  Similarity=0.316  Sum_probs=183.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             69999999999999879997754317771133467879999742046765555321111000022455544556402134
Q gi|254780685|r    4 SFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEVGSFISTGTELDFA   83 (243)
Q Consensus         4 ~~y~a~sg~~a~~~~ldvisNNlAN~~T~GfK~~~~~F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~l~~Tg~~lD~A   83 (243)
                      +||+|+|||.|+|++|+|++|||||+|||||||.++.|++++..     .....+|........|.||.++.|++++|+|
T Consensus         1 s~~~a~sGl~A~q~al~vts~NIANaNT~GYsRq~v~f~~~~~~-----~~~G~GV~v~~v~r~~~qg~~~~t~~~~d~a   75 (402)
T 3a69_A            1 SFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAG-----SKVGLGVKVAGITQDFTDGTTTNTGRGLDVA   75 (402)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHC---------------------------------------------------CEECC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHCC-----CCCCCCEEEEEEEEECCCCCEEECCCCCHHE
T ss_conf             97899999999997357888889877764206570207776466-----8776744776789841456457647600301


Q ss_pred             ECCCCEEEECCCCC-EEEEECCCCEECCCCCEECCCCCCCCCCCC-------------CCCCCC----------------
Q ss_conf             32750244136763-123211220156568454146885356645-------------442100----------------
Q gi|254780685|r   84 LEGDAWFALESPRG-IILTRDGRFKVTDDGSLVSASGKYPVLDMA-------------SVPIQI----------------  133 (243)
Q Consensus        84 i~G~GfF~V~~~~g-~~yTR~G~F~~d~~G~Lvt~~G~~~vl~~~-------------g~pI~i----------------  133 (243)
                      |.|+|||.+..++| .+|||.|+|.+|.+|+||+..|. .|++..             -.+|.+                
T Consensus        76 i~~~g~f~~~~~~g~~~~tr~g~~~~~~~g~lvn~~g~-~l~g~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~t~~~~~~  154 (402)
T 3a69_A           76 ISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGM-QLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQ  154 (402)
T ss_dssp             CSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCC-EEEEEECBTTTTBCCTTCCCEECCCCCCCCCCBCCCEEEEE
T ss_pred             ECCCCEEEEECCCCCEEEEECCCCCCCCCCCEECCCCC-EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             42786178862798643641565342788878637896-44123145777522256765552144445676553036763


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780685|r  134 --------------------------------------------------------------------------------  133 (243)
Q Consensus       134 --------------------------------------------------------------------------------  133 (243)
                                                                                                      
T Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~d~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (402)
T 3a69_A          155 INLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNEN  234 (402)
T ss_dssp             EEEETTCCCCSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTCCCCCSCSEEEEECTT
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEEEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCEEEEECCC
T ss_conf             02465555665344455776551333337998589972666678776378852379703666555466555226874146


Q ss_pred             --------------------------------------------------CCCCCCCCCCCCCCCCC-----CCCCCCCC
Q ss_conf             --------------------------------------------------00000000002454223-----43211233
Q gi|254780685|r  134 --------------------------------------------------PQKDEIFNVGEKGEISQ-----KGKVIATM  158 (243)
Q Consensus       134 --------------------------------------------------p~~~~~~~i~~dG~i~~-----~g~~v~~l  158 (243)
                                                                        +.....+.|++||.|..     ....++++
T Consensus       235 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~dG~~~~~~~~~~i~~dG~v~~~~~~~~~~~~~~~  314 (402)
T 3a69_A          235 GILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQI  314 (402)
T ss_dssp             SBEEECCEEEEECCCBTTBCCCEEEEECTTCEEESSCCCEEEEEEESCBCCCCEEEEEECTTCEEEEEETTSCEEEEEEE
T ss_pred             CCCCCCCCEECCCCCCCCCCCCCCCEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCC
T ss_conf             52145772000234545655543100001120013565311210246655542123421789559997356542100112


Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCCCCCCC-----CCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4545576134432025653456665654-----34566415624222140239999999999999999999999999999
Q gi|254780685|r  159 GLYSVDMSQGFVRRENSGISPNIPPTPL-----EDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKS  233 (243)
Q Consensus       159 ~l~~~~~~~~l~~~~~~~~~~~~~~~~~-----~~~~~~~v~qG~LE~SNVn~~~EMv~lI~~qRafe~~~k~i~~~de~  233 (243)
                      .++.|.++.+|...+++.|.........     .......|.||+||.||||+.+||++||..||+||+++|+|++.|||
T Consensus       315 ~~~~~~n~~~l~~~g~~~~~~~~~sg~~~~~~~~~~~~~~~~~~~lE~S~V~ldeEmtnli~~Q~aY~A~akvitt~dem  394 (402)
T 3a69_A          315 VLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQI  394 (402)
T ss_dssp             CEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCCC---------CHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCEEEEECCEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             34566785773304796064355677730067887873148107545114799999999999999999975266499999


Q ss_pred             HHHHHH
Q ss_conf             999999
Q gi|254780685|r  234 MLEAIR  239 (243)
Q Consensus       234 ~~~~in  239 (243)
                      |.++||
T Consensus       395 ld~lin  400 (402)
T 3a69_A          395 LNTLVN  400 (402)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             999970



>1wlg_A Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} SCOP: b.152.1.1 PDB: 2bgy_A 2bgz_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 243 flagellar basal body rod protein FlgF [Candidatus Liber
d1wlga_ 293 b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella 4e-05
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Length = 293 Back     information, alignment and structure

class: All beta proteins
fold: Flagellar hook protein flgE
superfamily: Flagellar hook protein flgE
family: Flagellar hook protein flgE
domain: Flagellar hook protein flgE
species: Salmonella typhimurium [TaxId: 90371]
 Score = 42.2 bits (98), Expect = 4e-05
 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 80  LDFALEGDAWFALESPRG-IILTRDGRFKVTDDGSLVSASGKY 121
           LD A+  + +F L    G +  +R+G+FK+ ++ +LV+  G  
Sbjct: 2   LDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQ 44


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
d1wlga_293 Flagellar hook protein flgE {Salmonella typhimurium [Ta 99.84
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: All beta proteins
fold: Flagellar hook protein flgE
superfamily: Flagellar hook protein flgE
family: Flagellar hook protein flgE
domain: Flagellar hook protein flgE
species: Salmonella typhimurium [TaxId: 90371]
Probab=99.84  E-value=8e-22  Score=145.48  Aligned_cols=122  Identities=20%  Similarity=0.377  Sum_probs=90.6

Q ss_pred             EEEEECCCCEEEECCCCC-EEEEECCCCEECCCCCEECCCCCCCCCCCC----C---------CCCCCC-----------
Q ss_conf             213432750244136763-123211220156568454146885356645----4---------421000-----------
Q gi|254780685|r   80 LDFALEGDAWFALESPRG-IILTRDGRFKVTDDGSLVSASGKYPVLDMA----S---------VPIQIP-----------  134 (243)
Q Consensus        80 lD~Ai~G~GfF~V~~~~g-~~yTR~G~F~~d~~G~Lvt~~G~~~vl~~~----g---------~pI~ip-----------  134 (243)
                      |||||+|+|||.|++++| ++|||+|+|++|++|+||+.+|. .|++..    +         .||.+|           
T Consensus         2 LDlAI~G~GFFvV~~~~g~~~YTRaG~F~~D~~G~Lvn~~G~-~l~G~~~d~~~~~~~~~~~~~~i~i~~~~~~~~aTt~   80 (293)
T d1wlga_           2 LDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGM-QLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTT   80 (293)
T ss_dssp             EECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCC-EEEEEECBTTTTBCCTTCCCEECCCCCCCBCCBCCCE
T ss_pred             CCEEECCCEEEEEECCCCCEEEECCCCEEECCCCCEECCCCC-EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             647874870799876999887844887329899998839999-8985763688863125776554434443457765514


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780685|r  135 --------------------------------------------------------------------------------  134 (243)
Q Consensus       135 --------------------------------------------------------------------------------  134 (243)
                                                                                                      
T Consensus        81 ~~~~~NL~~~~~~~~~~~~~~~~~~t~~~~~s~~vyDs~G~~~~v~~~f~k~~~~~w~~~~~~~~~~~~~~~~~~~~~l~  160 (293)
T d1wlga_          81 ASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLK  160 (293)
T ss_dssp             EEEEEEEETTCCCCSSCSCCTTCTTSCSEEEEEEEECTTCCEEEEEEEEEEEETTEEEEEEEETTCTTCCCCCSCSEEEE
T ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCEEEEEECCCCCCEEEEECCCCCCCCCCCCCEEEEE
T ss_conf             67741664212355322223478776330113676422586422205666204654137871256644546643135653


Q ss_pred             -------------------------------------------------------CCCCCCCCCCCCCCC---CCC--CC
Q ss_conf             -------------------------------------------------------000000000245422---343--21
Q gi|254780685|r  135 -------------------------------------------------------QKDEIFNVGEKGEIS---QKG--KV  154 (243)
Q Consensus       135 -------------------------------------------------------~~~~~~~i~~dG~i~---~~g--~~  154 (243)
                                                                             -.-..+.|++||.|.   .+|  +.
T Consensus       161 F~~~G~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~qdG~~~G~l~~~~i~~dG~i~~~ysNG~~~~  240 (293)
T d1wlga_         161 FNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQV  240 (293)
T ss_dssp             ECTTSBEEECCEEEEECCCBTTBCCCEEEEECTTCEEESSCCCEEEEEEECCBCCBCEEEEEECTTCEEEEEETTSCEEE
T ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCCEECCCCCCCCCCCCCCCEEEEECCCCCCCEEEEEEEECCCEEEEEEECCCCEEE
T ss_conf             27863222333100023441124321000252210001257400244326884311232106658758999976996789


Q ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCC-C----CCCCCEEEECCCCCC
Q ss_conf             12334545576134432025653456665654-3----456641562422214
Q gi|254780685|r  155 IATMGLYSVDMSQGFVRRENSGISPNIPPTPL-E----DLSGVTVKRGFLEDS  202 (243)
Q Consensus       155 v~~l~l~~~~~~~~l~~~~~~~~~~~~~~~~~-~----~~~~~~v~qG~LE~S  202 (243)
                      ++||.|+.|.||.+|.+.+++.|..+...+.+ .    .....+|.+|+||+|
T Consensus       241 lgqiala~F~Np~gL~~~g~n~f~~t~~SG~~~~g~~g~~g~G~i~~g~LE~S  293 (293)
T d1wlga_         241 LGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEAS  293 (293)
T ss_dssp             EEEECEEECSCGGGSEECSTTCEECCTTTCCCEEECTTBTTBCCCSSCEEEEC
T ss_pred             EEEEEEEEECCHHHHHHCCCCEEECCCCCCCCEECCCCCCCCEEEECCCEECC
T ss_conf             88999997359687321259708760016885556899888223842613169



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 243 flagellar basal body rod protein FlgF [Candidatus
3a69_A_48-116_315-358113 (A:48-116,A:315-358) Flagellar HOOK protein FLGE; 3e-11
1wlg_A_1-46_245-28183 (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EA 2e-09
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp}Length = 113 Back     alignment and structure
 Score = 63.2 bits (154), Expect = 3e-11
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 71  GSFISTGTELDFALEGDAWFALESPRG-IILTRDGRFKVTDDGSLVSASGKYPVLDMASV 129
           G+  +TG  LD A+  + +F L    G +  +R+G+FK+ ++ +LV+  G   +  +A+ 
Sbjct: 16  GTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQG-MQLTVLANF 74

Query: 130 P 130
            
Sbjct: 75  A 75


>1wlg_A (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium}Length = 83 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 flagellar basal body rod protein FlgF [Candidatus Liber
3a69_A_48-116_315-358113 Flagellar HOOK protein FLGE; the bacterial flagell 99.81
1wlg_A_1-46_245-28183 Flagellar HOOK protein FLGE; EAR-& motif, structur 99.63
>3a69_A (A:48-116,A:315-358) Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=99.81  E-value=1.1e-20  Score=141.01  Aligned_cols=93  Identities=20%  Similarity=0.322  Sum_probs=80.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEECCCCC-EEEEECCCCEECCCCCEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             32111100002245554455640213432750244136763-12321122015656845414688535664544210000
Q gi|254780685|r   57 SFVASGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRG-IILTRDGRFKVTDDGSLVSASGKYPVLDMASVPIQIPQ  135 (243)
Q Consensus        57 ~~~~~~~~~~~~~~G~l~~Tg~~lD~Ai~G~GfF~V~~~~g-~~yTR~G~F~~d~~G~Lvt~~G~~~vl~~~g~pI~ip~  135 (243)
                      .++....++++|+||+++.|++|||+||+|+|||.|++++| ++|||+|+|++|++|+||+.+|. +||           
T Consensus         2 ~Gv~~~~~~~~~~qG~l~~T~~~lDlAI~G~GfF~V~~~~G~~~yTR~G~F~ld~~G~Lvt~~G~-~vl-----------   69 (113)
T 3a69_A            2 LGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGM-QLT-----------   69 (113)
T ss_dssp             ----------------------CEECCCSSSCEEEEECTTCCEEEESCCEEEECTTSCEECTTCC-EEE-----------
T ss_pred             CCEEEEEEEEEECCCCEEECCCHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-----------
T ss_conf             76477679996045545762645566622786036751578600013454220478871235674-002-----------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCC
Q ss_conf             0000000024542234321123345455761344320256534566656
Q gi|254780685|r  136 KDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPNIPPT  184 (243)
Q Consensus       136 ~~~~~~i~~dG~i~~~g~~v~~l~l~~~~~~~~l~~~~~~~~~~~~~~~  184 (243)
                                             .|++|.++.+|.+.+++.|..+....
T Consensus        70 -----------------------al~~f~n~~gL~~~g~~~~~~t~~sG   95 (113)
T 3a69_A           70 -----------------------VLANFANNEGLASQGDNVWAATQASG   95 (113)
T ss_dssp             -----------------------CEEECSCGGGSEECSTTCEECCTTTC
T ss_pred             -----------------------CCCCCCCHHHHHHCCCCEEECCCCCC
T ss_conf             -----------------------34566786774413784476133567



>1wlg_A (A:1-46,A:245-281) Flagellar HOOK protein FLGE; EAR-& motif, structural protein; 1.80A {Salmonella typhimurium} Back     alignment and structure