255764488

255764488

flagellar motor protein MotA

GeneID in NCBI database:8209690Locus tag:CLIBASIA_02865
Protein GI in NCBI database:255764488Protein Accession:YP_003065099.2
Gene range:-(581028, 581900)Protein Length:290aa
Gene description:flagellar motor protein MotA
COG prediction:[N] Flagellar motor component
KEGG prediction:motA; flagellar motor protein MotA; K02556 chemotaxis protein MotA
SEED prediction:Flagellar motor rotation protein MotA
Pathway involved in KEGG:Two-component system [PATH:las02020]
Bacterial chemotaxis [PATH:las02030]
Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSAT4 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS
cHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHcccHHHHHHHHHccccccccc
ccEEEEEEEEEEEEccccEcccccccHEccHHHEHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccHHHHHcHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHEEHHEccccccccccccHHHHHHHHHccccHHHcc
MSTIIGLFITILCIIGgfyamggnpyiliqPFEIVIVAGAGlggfvmanplkvikDSGVSLLEIFgykalgqdtYCDVLKLLYILMYNLkkgsrnetenhiddpynstiftsiptvlennelttFICDYMRMIIVGNARSYEIENLMDEEIDIILYEklkpyhaishmgeslpaIGIVGAILGIIKAMgnlsqspkiLGTAIGVSLTGTLLGIILSYSlcnpltsqikstrlkQHRLYIIVKKALIAYMNGAIPQVAIEYgrkvlplserpsiEIVAQEVLQYNHNKKAS
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSqikstrlkqHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS
MStiiglfitilciiggfYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPaigivgailgiikaMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPL***********************
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQY*******
iiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS
MSTIIGLFITILCIIGGFYAMGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLKLLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARSYEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGTAIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEYGRKVLPLSERPSIEIVAQEVLQYNHNKKAS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target290 flagellar motor protein MotA [Candidatus Liberibacter a
315121853270 flagellar motor protein MotA [Candidatus Liberibacter s 1 1e-125
15887906290 flagellar motor protein MotA [Agrobacterium tumefaciens 1 1e-103
222084858290 chemotaxis motility protein [Agrobacterium radiobacter 1 5e-98
116250475290 flagellar motor protein MotA [Rhizobium leguminosarum b 1 6e-98
218461632290 flagellar motor protein MotA [Rhizobium etli Kim 5] Len 1 8e-98
209547921290 flagellar motor protein MotA [Rhizobium leguminosarum b 1 1e-97
190890356290 chemotaxis motility protein [Rhizobium etli CIAT 652] L 1 3e-97
241203099290 flagellar motor protein MotA [Rhizobium leguminosarum b 1 2e-96
222147564291 flagellar motor protein MotA [Agrobacterium vitis S4] L 1 2e-96
325291947290 flagellar motor protein MotA [Agrobacterium sp. H13-3] 1 3e-96
>gi|315121853|ref|YP_004062342.1| flagellar motor protein MotA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 270 Back     alignment and organism information
 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 218/270 (80%), Positives = 249/270 (92%)

Query: 21  MGGNPYILIQPFEIVIVAGAGLGGFVMANPLKVIKDSGVSLLEIFGYKALGQDTYCDVLK 80
           MGGN  ILIQPFEI+IV+GAGLGGF+MAN LKVIKDSGV++LEIFGYK++ ++ YCD+LK
Sbjct: 1   MGGNLSILIQPFEIIIVSGAGLGGFIMANSLKVIKDSGVAILEIFGYKSIEKEIYCDILK 60

Query: 81  LLYILMYNLKKGSRNETENHIDDPYNSTIFTSIPTVLENNELTTFICDYMRMIIVGNARS 140
           ++Y+LMY+LKK SR E ENHIDDP+NS+IFTSIPT+L NNELTTFICDY RM+I+GNA+S
Sbjct: 61  IMYVLMYSLKKISRTELENHIDDPHNSSIFTSIPTILSNNELTTFICDYFRMVIIGNAQS 120

Query: 141 YEIENLMDEEIDIILYEKLKPYHAISHMGESLPAIGIVGAILGIIKAMGNLSQSPKILGT 200
           +EIE LMDEEI+IILYEKLKPYHAIS+MGES PAIGIVGAILGIIKAMGNLSQSPKILG 
Sbjct: 121 HEIETLMDEEIEIILYEKLKPYHAISNMGESFPAIGIVGAILGIIKAMGNLSQSPKILGV 180

Query: 201 AIGVSLTGTLLGIILSYSLCNPLTSQIKSTRLKQHRLYIIVKKALIAYMNGAIPQVAIEY 260
           AIG SLTGT+LGI+LSY +CNPLTSQI S RL+QHRLYIIVKK LIAYMNGAIPQVAIEY
Sbjct: 181 AIGASLTGTMLGILLSYCICNPLTSQIHSIRLRQHRLYIIVKKTLIAYMNGAIPQVAIEY 240

Query: 261 GRKVLPLSERPSIEIVAQEVLQYNHNKKAS 290
           GRKVLPL ERPSIEIV QEVL+Y+++KK S
Sbjct: 241 GRKVLPLFERPSIEIVEQEVLRYSNHKKES 270


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15887906|ref|NP_353587.1| flagellar motor protein MotA [Agrobacterium tumefaciens str. C58] Length = 290 Back     alignment and organism information
>gi|222084858|ref|YP_002543387.1| chemotaxis motility protein [Agrobacterium radiobacter K84] Length = 290 Back     alignment and organism information
>gi|116250475|ref|YP_766313.1| flagellar motor protein MotA [Rhizobium leguminosarum bv. viciae 3841] Length = 290 Back     alignment and organism information
>gi|218461632|ref|ZP_03501723.1| flagellar motor protein MotA [Rhizobium etli Kim 5] Length = 290 Back     alignment and organism information
>gi|209547921|ref|YP_002279838.1| flagellar motor protein MotA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 290 Back     alignment and organism information
>gi|190890356|ref|YP_001976898.1| chemotaxis motility protein [Rhizobium etli CIAT 652] Length = 290 Back     alignment and organism information
>gi|241203099|ref|YP_002974195.1| flagellar motor protein MotA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 290 Back     alignment and organism information
>gi|222147564|ref|YP_002548521.1| flagellar motor protein MotA [Agrobacterium vitis S4] Length = 291 Back     alignment and organism information
>gi|325291947|ref|YP_004277811.1| flagellar motor protein MotA [Agrobacterium sp. H13-3] Length = 290 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target290 flagellar motor protein MotA [Candidatus Liberibacter a
PRK09110283 PRK09110, PRK09110, flagellar motor protein MotA; Valid 4e-93
TIGR03818282 TIGR03818, MotA1, flagellar motor stator protein MotA 4e-88
PRK12482287 PRK12482, PRK12482, flagellar motor protein MotA; Provi 1e-46
PRK08124263 PRK08124, PRK08124, flagellar motor protein MotA; Valid 9e-16
PRK08456257 PRK08456, PRK08456, flagellar motor protein MotA; Valid 1e-06
COG1291266 COG1291, MotA, Flagellar motor component [Cell motility 8e-61
PRK09109246 PRK09109, motC, flagellar motor protein; Reviewed 7e-07
PRK08990254 PRK08990, PRK08990, flagellar motor protein PomA; Revie 3e-05
PRK06743254 PRK06743, PRK06743, flagellar motor protein MotP; Revie 1e-04
PRK09109246 PRK09109, motC, flagellar motor protein; Reviewed 0.003
>gnl|CDD|181655 PRK09110, PRK09110, flagellar motor protein MotA; Validated Back     alignment and domain information
>gnl|CDD|163530 TIGR03818, MotA1, flagellar motor stator protein MotA Back     alignment and domain information
>gnl|CDD|171532 PRK12482, PRK12482, flagellar motor protein MotA; Provisional Back     alignment and domain information
>gnl|CDD|181238 PRK08124, PRK08124, flagellar motor protein MotA; Validated Back     alignment and domain information
>gnl|CDD|181434 PRK08456, PRK08456, flagellar motor protein MotA; Validated Back     alignment and domain information
>gnl|CDD|31482 COG1291, MotA, Flagellar motor component [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|181654 PRK09109, motC, flagellar motor protein; Reviewed Back     alignment and domain information
>gnl|CDD|181604 PRK08990, PRK08990, flagellar motor protein PomA; Reviewed Back     alignment and domain information
>gnl|CDD|136027 PRK06743, PRK06743, flagellar motor protein MotP; Reviewed Back     alignment and domain information
>gnl|CDD|181654 PRK09109, motC, flagellar motor protein; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 290 flagellar motor protein MotA [Candidatus Liberibacter a
PRK09110283 flagellar motor protein MotA; Validated 100.0
PRK12482287 flagellar motor protein MotA; Provisional 100.0
PRK08124263 flagellar motor protein MotA; Validated 100.0
PRK08456257 flagellar motor protein MotA; Validated 100.0
PRK06926272 flagellar motor protein MotP; Reviewed 100.0
COG1291266 MotA Flagellar motor component [Cell motility and secre 100.0
PRK06743254 flagellar motor protein MotP; Reviewed 100.0
PRK09109246 motC flagellar motor protein; Reviewed 100.0
PRK08990253 flagellar motor protein PomA; Reviewed 100.0
pfam01618139 MotA_ExbB MotA/TolQ/ExbB proton channel family. This fa 99.7
COG0811216 TolQ Biopolymer transport proteins [Intracellular traff 99.61
PRK10801227 colicin uptake protein TolQ; Provisional 99.37
PRK10414239 biopolymer transport protein ExbB; Provisional 99.15
TIGR02796219 tolQ protein TolQ; InterPro: IPR014163 TolQ is one of t 98.85
TIGR02797213 exbB tonB-system energizer ExbB; InterPro: IPR014164 Th 97.98
TIGR02805139 exbB2 tonB-system energizer ExbB; InterPro: IPR014172 M 97.63
PRK03982288 heat shock protein HtpX; Provisional 94.68
PRK06926272 flagellar motor protein MotP; Reviewed 94.28
>PRK09110 flagellar motor protein MotA; Validated Back     alignment and domain information
>PRK12482 flagellar motor protein MotA; Provisional Back     alignment and domain information
>PRK08124 flagellar motor protein MotA; Validated Back     alignment and domain information
>PRK08456 flagellar motor protein MotA; Validated Back     alignment and domain information
>PRK06926 flagellar motor protein MotP; Reviewed Back     alignment and domain information
>COG1291 MotA Flagellar motor component [Cell motility and secretion] Back     alignment and domain information
>PRK06743 flagellar motor protein MotP; Reviewed Back     alignment and domain information
>PRK09109 motC flagellar motor protein; Reviewed Back     alignment and domain information
>PRK08990 flagellar motor protein PomA; Reviewed Back     alignment and domain information
>pfam01618 MotA_ExbB MotA/TolQ/ExbB proton channel family Back     alignment and domain information
>COG0811 TolQ Biopolymer transport proteins [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10801 colicin uptake protein TolQ; Provisional Back     alignment and domain information
>PRK10414 biopolymer transport protein ExbB; Provisional Back     alignment and domain information
>TIGR02796 tolQ protein TolQ; InterPro: IPR014163 TolQ is one of the essential components of the Tol-Pal system Back     alignment and domain information
>TIGR02797 exbB tonB-system energizer ExbB; InterPro: IPR014164 This entry describes ExbB proteins, part of the MotA/TolQ/ExbB protein family Back     alignment and domain information
>TIGR02805 exbB2 tonB-system energizer ExbB; InterPro: IPR014172 Members of this protein family appear to be the ExbB protein of an ExbBD proton-transporting membrane complex that, by means of TonB, energizes transport by TonB-dependent receptors Back     alignment and domain information
>PRK03982 heat shock protein HtpX; Provisional Back     alignment and domain information
>PRK06926 flagellar motor protein MotP; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00