254780687

254780687

flagellar C-ring protein

GeneID in NCBI database:8209691Locus tag:CLIBASIA_02870
Protein GI in NCBI database:254780687Protein Accession:YP_003065100.1
Gene range:-(580068, 581024)Protein Length:318aa
Gene description:flagellar C-ring protein
COG prediction:none
KEGG prediction:fliM; flagellar C-ring protein; K02416 flagellar motor switch protein FliM
SEED prediction:Flagellar motor switch protein FliM
Pathway involved in KEGG:Bacterial chemotaxis [PATH:las02030]
Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR
cccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEHHHHHHcccccEEEEEEEccccccEEEEEEcHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHcccccEEEEEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccEEEEEEEEEccEEcHHHHHccccccEEEcccccccEEEEEEccEEEEEEEEEEEccEEEEEEEcccccHHHHHHHHHHcc
ccccHHHHHHcHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEcHHHHHccccccEEEEEEcccccccEEEEEcHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccccEEEEEEEEEEEEcccccEEEEEEEcHccccHHHcccccccccccccHHHHHHHHHHHHHccEEEEEEEEccEccHHHHHHcccccEEEcccccccEEEEEEccEEEEEEEEcccccEEEEEEEccccccHHHHHHHHHcc
mrgqsihkntsplHPILLARLtgklgdkkTIEKISSSLGYLYKKFLPKIFKekmdldvdisytscqsgkfshiIHSFKENFVfsqaslsswssnffigcSNNLVITLLENllgashetipQLYNRSLSTVEKKLAKRTIAQISAVLNQCISttqesspnledfydidylkkntnRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSsqnksenqsedlidpfarktyqlNVNIDTRinlkkttlkdvvtlkigqvipflhrEKTCAILSANGkeiyscelgrvgknytIRITDRINFDQKSLKNFLHKR
mrgqsihkntsplhpILLARLTGKLGDKKTIEKIssslgylyKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISttqesspnledFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLssqnksenqsedlidpfarktyqlnvnidtrinlkkttlkdvvtlkigqvipflhrEKTCAILsangkeiyscelgrVGKNYtiritdrinfdqkslknflhkr
MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQEtllkttlislssQNKSENQSEDLIDPFARKTYQLNVNIDTRINlkkttlkdvvtlkIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR
****************LLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLG*************LSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTT***********************KTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRI**************
*********TSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLS*********EDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR
***QSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR
MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR
MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLKNFLHKR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target318 flagellar C-ring protein [Candidatus Liberibacter asiat
315121854318 flagellar motor switch protein fliM [Candidatus Liberib 1 1e-114
241203098316 surface presentation of antigens (SPOA) protein [Rhizob 1 2e-53
116250474316 flagella motor switch protein [Rhizobium leguminosarum 1 9e-53
327193028314 flagellar C-ring motor switch protein [Rhizobium etli C 1 1e-52
222084857314 flagellar C-ring protein [Agrobacterium radiobacter K84 1 2e-52
190890355316 flagellar C-ring motor switch protein [Rhizobium etli C 1 3e-52
222147563319 flagellar motor switch protein [Agrobacterium vitis S4] 1 3e-52
86356304316 flagellar C-ring protein [Rhizobium etli CFN 42] Length 1 8e-52
209547920316 hypothetical protein Rleg2_0312 [Rhizobium leguminosaru 1 3e-51
325291948319 Flagellar motor switch protein [Agrobacterium sp. H13-3 1 2e-45
>gi|315121854|ref|YP_004062343.1| flagellar motor switch protein fliM [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 318 Back     alignment and organism information
 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/317 (65%), Positives = 254/317 (80%)

Query: 1   MRGQSIHKNTSPLHPILLARLTGKLGDKKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDI 60
           MR +   K+ SPLHP+LLARLTGKLGDKKTIE+IS +LG LY K LPK FKE++D+D+++
Sbjct: 1   MREKRTSKDISPLHPVLLARLTGKLGDKKTIERISYNLGQLYTKLLPKSFKEELDVDLNV 60

Query: 61  SYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITLLENLLGASHETIP 120
           SY + QSGKFSHI+HSFKE FVF + SL+  SSN FIGCSNNLVI LLE LL AS ET  
Sbjct: 61  SYGNYQSGKFSHILHSFKERFVFYKTSLNGRSSNLFIGCSNNLVIVLLETLLRASCETTQ 120

Query: 121 QLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEF 180
           + +NRSLST+EKKLA   + +I+ VL+QCIST Q +   L++ Y++D+LK+NTN LSNEF
Sbjct: 121 KSHNRSLSTIEKKLAHLIVTKIATVLDQCISTAQNNRVTLDENYELDFLKQNTNLLSNEF 180

Query: 181 VTTINMNMTIENVASSFVLIIPQETLLKTTLISLSSQNKSENQSEDLIDPFARKTYQLNV 240
           VT I M +TI+N+AS F LIIPQETLLK TLISLS Q KS    ED  D     TY+++V
Sbjct: 181 VTAITMVVTIDNIASLFTLIIPQETLLKITLISLSEQGKSAIPLEDCPDQLNGNTYKIHV 240

Query: 241 NIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRI 300
            I++RINL+K TLKDV+ LKIGQV+PFL +EK  AIL+ANGKEIYSCELGR+GKNYT+RI
Sbjct: 241 KIESRINLQKITLKDVLNLKIGQVMPFLDKEKVYAILNANGKEIYSCELGRIGKNYTVRI 300

Query: 301 TDRINFDQKSLKNFLHK 317
            DRINFDQ+SL+NFLHK
Sbjct: 301 QDRINFDQESLRNFLHK 317


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203098|ref|YP_002974194.1| surface presentation of antigens (SPOA) protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 316 Back     alignment and organism information
>gi|116250474|ref|YP_766312.1| flagella motor switch protein [Rhizobium leguminosarum bv. viciae 3841] Length = 316 Back     alignment and organism information
>gi|327193028|gb|EGE59940.1| flagellar C-ring motor switch protein [Rhizobium etli CNPAF512] Length = 314 Back     alignment and organism information
>gi|222084857|ref|YP_002543386.1| flagellar C-ring protein [Agrobacterium radiobacter K84] Length = 314 Back     alignment and organism information
>gi|190890355|ref|YP_001976897.1| flagellar C-ring motor switch protein [Rhizobium etli CIAT 652] Length = 316 Back     alignment and organism information
>gi|222147563|ref|YP_002548520.1| flagellar motor switch protein [Agrobacterium vitis S4] Length = 319 Back     alignment and organism information
>gi|86356304|ref|YP_468196.1| flagellar C-ring protein [Rhizobium etli CFN 42] Length = 316 Back     alignment and organism information
>gi|209547920|ref|YP_002279837.1| hypothetical protein Rleg2_0312 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 316 Back     alignment and organism information
>gi|325291948|ref|YP_004277812.1| Flagellar motor switch protein [Agrobacterium sp. H13-3] Length = 319 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target318 flagellar C-ring protein [Candidatus Liberibacter asiat
PRK06666337 PRK06666, fliM, flagellar motor switch protein FliM; Va 3e-11
TIGR01397320 TIGR01397, fliM_switch, flagellar motor switch protein 9e-10
pfam0105277 pfam01052, SpoA, Surface presentation of antigens (SPOA 9e-08
COG1886136 COG1886, FliN, Flagellar motor switch/type III secretor 1e-04
COG1868332 COG1868, FliM, Flagellar motor switch protein [Cell mot 1e-32
>gnl|CDD|180651 PRK06666, fliM, flagellar motor switch protein FliM; Validated Back     alignment and domain information
>gnl|CDD|130464 TIGR01397, fliM_switch, flagellar motor switch protein FliM Back     alignment and domain information
>gnl|CDD|144589 pfam01052, SpoA, Surface presentation of antigens (SPOA) Back     alignment and domain information
>gnl|CDD|32070 COG1886, FliN, Flagellar motor switch/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|32053 COG1868, FliM, Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 318 flagellar C-ring protein [Candidatus Liberibacter asiat
PRK12795378 fliM flagellar motor switch protein FliM; Reviewed 100.0
PRK06666336 fliM flagellar motor switch protein FliM; Validated 100.0
COG1868332 FliM Flagellar motor switch protein [Cell motility and 100.0
PRK08119390 flagellar motor switch protein; Validated 100.0
TIGR01397328 fliM_switch flagellar motor switch protein FliM; InterP 100.0
PRK06782547 flagellar motor switch protein; Reviewed 99.97
pfam02154192 FliM Flagellar motor switch protein FliM. 100.0
PRK06782 547 flagellar motor switch protein; Reviewed 99.18
PRK08432281 flagellar motor switch protein FliY; Validated 99.95
PRK05933371 type III secretion system protein; Validated 99.23
PRK08983126 fliN flagellar motor switch protein; Validated 99.74
PRK07963137 fliN flagellar motor switch protein FliN; Validated 99.73
TIGR0248077 fliN flagellar motor switch protein FliN; InterPro: IPR 99.7
pfam0105277 SpoA Surface presentation of antigens (SPOA). This fami 99.7
PRK05698155 fliN flagellar motor switch protein; Validated 99.69
PRK08433111 flagellar motor switch protein; Validated 99.68
PRK08916114 flagellar motor switch protein; Reviewed 99.66
PRK0603387 hypothetical protein; Validated 99.63
PRK06788119 flagellar motor switch protein; Validated 99.59
COG1886136 FliN Flagellar motor switch/type III secretory pathway 99.5
TIGR02551326 SpaO_YscQ type III secretion apparatus protein, YscQ/Hr 99.26
PRK06933307 type III secretion system protein; Validated 98.96
PRK08158303 surface presentation of antigens protein SpaO; Validate 98.9
PRK08035326 type III secretion system protein; Validated 98.17
PRK06933307 type III secretion system protein; Validated 96.76
PRK05933371 type III secretion system protein; Validated 96.15
PRK0678961 flagellar motor switch protein; Validated 95.8
COG1776203 CheC Chemotaxis protein CheC, inhibitor of MCP methylat 98.65
PRK08158303 surface presentation of antigens protein SpaO; Validate 94.34
TIGR02551 326 SpaO_YscQ type III secretion apparatus protein, YscQ/Hr 92.73
>PRK12795 fliM flagellar motor switch protein FliM; Reviewed Back     alignment and domain information
>PRK06666 fliM flagellar motor switch protein FliM; Validated Back     alignment and domain information
>COG1868 FliM Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information
>PRK08119 flagellar motor switch protein; Validated Back     alignment and domain information
>TIGR01397 fliM_switch flagellar motor switch protein FliM; InterPro: IPR001689 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour Back     alignment and domain information
>PRK06782 flagellar motor switch protein; Reviewed Back     alignment and domain information
>pfam02154 FliM Flagellar motor switch protein FliM Back     alignment and domain information
>PRK06782 flagellar motor switch protein; Reviewed Back     alignment and domain information
>PRK08432 flagellar motor switch protein FliY; Validated Back     alignment and domain information
>PRK05933 type III secretion system protein; Validated Back     alignment and domain information
>PRK08983 fliN flagellar motor switch protein; Validated Back     alignment and domain information
>PRK07963 fliN flagellar motor switch protein FliN; Validated Back     alignment and domain information
>TIGR02480 fliN flagellar motor switch protein FliN; InterPro: IPR012826 Proteins that consist largely of this domain can be designated flagellar motor switch proteins: FliN Back     alignment and domain information
>pfam01052 SpoA Surface presentation of antigens (SPOA) Back     alignment and domain information
>PRK05698 fliN flagellar motor switch protein; Validated Back     alignment and domain information
>PRK08433 flagellar motor switch protein; Validated Back     alignment and domain information
>PRK08916 flagellar motor switch protein; Reviewed Back     alignment and domain information
>PRK06033 hypothetical protein; Validated Back     alignment and domain information
>PRK06788 flagellar motor switch protein; Validated Back     alignment and domain information
>COG1886 FliN Flagellar motor switch/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02551 SpaO_YscQ type III secretion apparatus protein, YscQ/HrcQ family; InterPro: IPR013385 Proteins in this entry are encoded within type III secretion operons and are involved in many different functions Back     alignment and domain information
>PRK06933 type III secretion system protein; Validated Back     alignment and domain information
>PRK08158 surface presentation of antigens protein SpaO; Validated Back     alignment and domain information
>PRK08035 type III secretion system protein; Validated Back     alignment and domain information
>PRK06933 type III secretion system protein; Validated Back     alignment and domain information
>PRK05933 type III secretion system protein; Validated Back     alignment and domain information
>PRK06789 flagellar motor switch protein; Validated Back     alignment and domain information
>COG1776 CheC Chemotaxis protein CheC, inhibitor of MCP methylation [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK08158 surface presentation of antigens protein SpaO; Validated Back     alignment and domain information
>TIGR02551 SpaO_YscQ type III secretion apparatus protein, YscQ/HrcQ family; InterPro: IPR013385 Proteins in this entry are encoded within type III secretion operons and are involved in many different functions Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target318 flagellar C-ring protein [Candidatus Liberibacter asiat
2hp7_A183 Structure Of Flim Provides Insight Into Assembly Of 2e-30
1yab_A87 Structure Of T. Maritima Flin Flagellar Rotor Prote 5e-11
1o6a_A96 Crystal Structure Of A C-Terminal Fragment Of The P 6e-10
>gi|114794453|pdb|2HP7|A Chain A, Structure Of Flim Provides Insight Into Assembly Of The Switch Complex In The Bacterial Flagella Motor Length = 183 Back     alignment and structure
 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 61/185 (32%), Gaps = 6/185 (3%)

Query: 28  KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQAS 87
            K   +    +   + + L      ++   VD+   S     +   I S          +
Sbjct: 5   SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI-SIDQLTYEEFIRSVMIPSFIVIFT 63

Query: 88  LSSWSSNFFIGCSNNLVITLLENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLN 147
              +  +       +L  T+L+ ++G   E  P   NR  + +E  + ++ +  +  +L 
Sbjct: 64  GDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPP---NRPPTEIETSIMRKEVTNMLTLLA 120

Query: 148 QCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMNMTIENVASSFVLIIPQETLL 207
           Q  S  Q   P++E+       +       NE V  +  +++     S   +  P   L 
Sbjct: 121 QAWSDFQYFIPSIENVET--NPQFVQIVPPNEIVLLVTASVSWGEFTSFINVCWPFSLLE 178

Query: 208 KTTLI 212
                
Sbjct: 179 PLLEK 183


>gi|71042010|pdb|1YAB|A Chain A, Structure Of T. Maritima Flin Flagellar Rotor Protein Length = 87 Back     alignment and structure
>gi|39654324|pdb|1O6A|A Chain A, Crystal Structure Of A C-Terminal Fragment Of The Putative Flagelar Motor Switch Protein Flin (Tm0680) From Thermotoga Maritima At 1.85 A Resolution Length = 96 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target318 flagellar C-ring protein [Candidatus Liberibacter asiat
1o6a_A96 Putative flagelar motor switch protein FLIN; TM0680A, C 3e-08
1o9y_A84 HRCQ2; secretory protein, HRP, type III secretion syste 8e-06
>1o6a_A Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima} SCOP: b.139.1.1 PDB: 1yab_A Length = 96 Back     alignment and structure
 Score = 54.7 bits (132), Expect = 3e-08
 Identities = 18/99 (18%), Positives = 41/99 (41%), Gaps = 6/99 (6%)

Query: 216 SQNKSENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCA 275
           S+ +      D ++        + + +   +   + TLK V+ +  G +I          
Sbjct: 1   SETRKTEVPSDKLELL----LDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPV 56

Query: 276 ILSANGKEIYSCELGRVGKNYTIRITDRINFDQ--KSLK 312
            +  NGK I   E+  + +N+ +RIT+ ++  +  + L 
Sbjct: 57  DILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLN 95


>1o9y_A HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae} SCOP: b.139.1.1 Length = 84 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 flagellar C-ring protein [Candidatus Liberibacter asiat
2hp7_A183 Flagellar motor switch protein FLIM; bacterial chemotax 100.0
1xkr_A206 Chemotaxis protein CHEC; signal transduction, protein p 98.82
3hm4_A156 Chemotaxis protein CHEX; YP_386777.1, structural genomi 97.15
3hzh_B172 Chemotaxis operon protein (CHEX); phosphatase, complex, 97.03
3h2d_A155 CHEC-like superfamily protein; NP_719446.1, structural 96.83
1o6a_A96 Putative flagelar motor switch protein FLIN; TM0680A, C 99.73
1o9y_A84 HRCQ2; secretory protein, HRP, type III secretion syste 99.64
1squ_A155 CHEX protein; alpha-beta sandwich, structural genomics, 95.46
>2hp7_A Flagellar motor switch protein FLIM; bacterial chemotaxis, flagellar switch complex, signaling protein; 2.00A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=1e-35  Score=251.93  Aligned_cols=179  Identities=15%  Similarity=0.137  Sum_probs=170.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEHHHHHHCCCCCEEEEEEECCCCCCEEEEEECHHHHHHH
Q ss_conf             66799999999999999999999986298079986472566799897116886399999736778339999887899999
Q gi|254780687|r   28 KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITL  107 (318)
Q Consensus        28 ~~~~~~~~~~~~e~~~r~l~~~l~~~~~~~v~v~~~~ve~~~~~e~i~~l~~p~~~~i~~~~pl~g~~ll~id~~l~~~l  107 (318)
                      ++...++++.++|+|+|.++..|++++|..++|++ ++++.+|+||++++|.|+++++++++||+|++++.+|++++|++
T Consensus         5 ske~l~~L~~I~e~far~~~~~l~~~lr~~~~v~~-~v~~~~~~ef~~~l~~p~~l~i~~~~pl~g~~ll~i~~~l~~~~   83 (183)
T 2hp7_A            5 SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI-SIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTM   83 (183)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCEEEE-EEEEEEHHHHHHHSCSSCEEEEEEETTCSSCEEEEECHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE-EEEEEEHHHHHHHCCCCEEEEEEEECCCCCCEEEEECHHHHHHH
T ss_conf             35466799999999999999999998688847999-46899899999658887289998604658807999886999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHCHHHHCCCCCCCEEEEEEEE
Q ss_conf             98872788876666665657989999999999999999999851002732000002443110000124787189999988
Q gi|254780687|r  108 LENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN  187 (318)
Q Consensus       108 id~~lGG~g~~~~~~~~R~lT~iE~~l~~~i~~~~~~~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~p~e~vi~i~~~  187 (318)
                      ||++|||.|...   ++|+||+||.++++++++.++++|.++|+++.++++.+...++  |+++++++.|+|.+++++|+
T Consensus        84 vD~l~GG~g~~~---~~R~lT~iE~~i~~~i~~~~~~~l~~aw~~~~~~~~~~~~~e~--np~~~~i~~~~e~vv~~~f~  158 (183)
T 2hp7_A           84 LDIIMGGPGENP---PNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVET--NPQFVQIVPPNEIVLLVTAS  158 (183)
T ss_dssp             HHHHHTCC-------CCSCCCHHHHHHHHHHHHHHHHHHHHHTHHHHCCCEEEEEEES--CGGGCCSSCTTSEEEEEEEE
T ss_pred             HHHHCCCCCCCC---CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC--CHHHHCCCCCCCEEEEEEEE
T ss_conf             999748999988---9987868889999999999999999998533137740334233--86765638999859999999


Q ss_pred             EEECCEEEEEEEEEEHHHHHHHHHH
Q ss_conf             6667813799998504775256775
Q gi|254780687|r  188 MTIENVASSFVLIIPQETLLKTTLI  212 (318)
Q Consensus       188 v~~~~~~g~~~l~lP~~~l~~~~~~  212 (318)
                      +++|+.+|.+++|+||++++|++++
T Consensus       159 v~~g~~~g~~~i~iP~~~Lepi~~k  183 (183)
T 2hp7_A          159 VSWGEFTSFINVCWPFSLLEPLLEK  183 (183)
T ss_dssp             EEETTEEEEEEEEEEHHHHHHHHHC
T ss_pred             EEECCCCEEEEEEEHHHHHHHHCCC
T ss_conf             9989964299999638841433069



>1xkr_A Chemotaxis protein CHEC; signal transduction, protein phosphatase, attractant; 1.75A {Thermotoga maritima} SCOP: d.252.1.1 PDB: 2f9z_A Back     alignment and structure
>3hm4_A Chemotaxis protein CHEX; YP_386777.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.30A {Desulfovibrio desulfuricans subsp} PDB: 3h4y_A* Back     alignment and structure
>3hzh_B Chemotaxis operon protein (CHEX); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3h2d_A CHEC-like superfamily protein; NP_719446.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Shewanella oneidensis mr-1} PDB: 3iic_A* Back     alignment and structure
>1o6a_A Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima} SCOP: b.139.1.1 PDB: 1yab_A Back     alignment and structure
>1o9y_A HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae} SCOP: b.139.1.1 Back     alignment and structure
>1squ_A CHEX protein; alpha-beta sandwich, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.40A {Thermotoga maritima} SCOP: d.252.1.1 PDB: 1xko_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 318 flagellar C-ring protein [Candidatus Liberibacter asiat
d1o6aa_87 b.139.1.1 (A:) Putative flagelar motor switch protein F 2e-08
d1o9ya_71 b.139.1.1 (A:) Structural protein HrcQ2, C-terminal dom 4e-06
>d1o6aa_ b.139.1.1 (A:) Putative flagelar motor switch protein FliN {Thermotoga maritima [TaxId: 2336]} Length = 87 Back     information, alignment and structure

class: All beta proteins
fold: Surface presentation of antigens (SPOA)
superfamily: Surface presentation of antigens (SPOA)
family: Surface presentation of antigens (SPOA)
domain: Putative flagelar motor switch protein FliN
species: Thermotoga maritima [TaxId: 2336]
 Score = 53.8 bits (130), Expect = 2e-08
 Identities = 16/77 (20%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 238 LNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYT 297
           + + +   +   + TLK V+ +  G +I           +  NGK I   E+  + +N+ 
Sbjct: 10  IPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFG 69

Query: 298 IRITDRINFDQ--KSLK 312
           +RIT+ ++  +  + L 
Sbjct: 70  VRITEIVSPKERLELLN 86


>d1o9ya_ b.139.1.1 (A:) Structural protein HrcQ2, C-terminal domain {Pseudomonas syringae [TaxId: 317]} Length = 71 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 flagellar C-ring protein [Candidatus Liberibacter asiat
d1o6aa_87 Putative flagelar motor switch protein FliN {Thermotoga 99.72
d1o9ya_71 Structural protein HrcQ2, C-terminal domain {Pseudomona 99.63
d1xkra_205 Chemotaxis protein CheC {Thermotoga maritima [TaxId: 23 98.88
d1xkoa_153 Chemotaxis protein CheX {Thermotoga maritima [TaxId: 23 96.41
>d1o6aa_ b.139.1.1 (A:) Putative flagelar motor switch protein FliN {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All beta proteins
fold: Surface presentation of antigens (SPOA)
superfamily: Surface presentation of antigens (SPOA)
family: Surface presentation of antigens (SPOA)
domain: Putative flagelar motor switch protein FliN
species: Thermotoga maritima [TaxId: 2336]
Probab=99.72  E-value=3.5e-17  Score=128.86  Aligned_cols=81  Identities=20%  Similarity=0.295  Sum_probs=75.2

Q ss_pred             HHHHHCEEEEEEEEEEEEECHHHHHCCCCCCEEECCCCCCCEEEEEECCEEEEEEEEEEECCEEEEEEEECCCCHHHHHH
Q ss_conf             99740800799998123430989945799978982578997389999999999999987889789999842581467888
Q gi|254780687|r  233 RKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSANGKEIYSCELGRVGKNYTIRITDRINFDQKSLK  312 (318)
Q Consensus       233 ~~l~~~~v~i~a~Lg~~~l~l~dil~L~vGDVI~L~~~~~~~v~v~v~g~~~f~g~~G~~~~~~AVrI~~~i~~~~~~l~  312 (318)
                      +.++++||+++|+||+++++++|+++|++||||+|+.+.+++++++|||+++|+|++|.+|+++||||++.+..+++ ++
T Consensus         5 ~~i~dipv~l~~~Lg~~~l~l~el~~L~~Gdvi~L~~~~~~~v~l~v~g~~~~~g~lg~~~~~~av~I~~~i~~~e~-~~   83 (87)
T d1o6aa_           5 ELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKER-LE   83 (87)
T ss_dssp             HHHTTCEEEEEEEEEEEEEEHHHHHHCCTTCEEEEEEETTCCEEEEETTEEEEEEEEEEETTEEEEEEEEECCHHHH-HH
T ss_pred             HHHCCCCEEEEEEEEEEEEEHHHHHCCCCCCEEEECCCCCCCEEEEECCEEEEEEEEEEECCEEEEEEEEECCCHHH-HH
T ss_conf             23326717999999300845999857999999991898999799999999999999999999999999981595899-88


Q ss_pred             HH
Q ss_conf             87
Q gi|254780687|r  313 NF  314 (318)
Q Consensus       313 ~~  314 (318)
                      .+
T Consensus        84 ~l   85 (87)
T d1o6aa_          84 LL   85 (87)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             64



>d1o9ya_ b.139.1.1 (A:) Structural protein HrcQ2, C-terminal domain {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1xkra_ d.252.1.1 (A:) Chemotaxis protein CheC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkoa_ d.252.1.1 (A:) Chemotaxis protein CheX {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 318 flagellar C-ring protein [Candidatus Liberibacter
1o9y_A_84 (A:) HRCQ2; secretory protein, HRP, type III secre 1e-09
1o6a_A_20-9677 (A:20-96) Putative flagelar motor switch protein F 4e-09
>1o9y_A (A:) HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae}Length = 84 Back     alignment and structure
 Score = 58.1 bits (141), Expect = 1e-09
 Identities = 14/86 (16%), Positives = 28/86 (32%), Gaps = 4/86 (4%)

Query: 220 SENQSEDLIDPFARKTYQLNVNIDTRINLKKTTLKDVVTLKIGQVIPFLHREKTCAILSA 279
                +D           L +++  R    + TL ++  L  G ++         A L  
Sbjct: 1   GAMDPQDEPPALD----SLALDLTLRCGELRLTLAELRRLDAGTILEVTGISPGHATLCH 56

Query: 280 NGKEIYSCELGRVGKNYTIRITDRIN 305
             + +   EL  V     ++IT  + 
Sbjct: 57  GEQVVAEGELVDVEGRLGLQITRLVT 82


>1o6a_A (A:20-96) Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima}Length = 77 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target318 flagellar C-ring protein [Candidatus Liberibacter asiat
2hp7_A_183 Flagellar motor switch protein FLIM; bacterial che 99.94
1xkr_A_206 Chemotaxis protein CHEC; signal transduction, prot 99.48
3hzh_B_172 Chemotaxis operon protein (CHEX); phosphatase, com 98.99
3h2d_A_155 CHEC-like superfamily protein; NP_719446.1, struct 97.51
3hm4_A_156 Chemotaxis protein CHEX; YP_386777.1, structural g 97.49
1o9y_A_84 HRCQ2; secretory protein, HRP, type III secretion 99.75
1o6a_A_20-9677 Putative flagelar motor switch protein FLIN; TM068 99.68
1squ_A_155 CHEX protein; alpha-beta sandwich, structural geno 97.09
>2hp7_A (A:) Flagellar motor switch protein FLIM; bacterial chemotaxis, flagellar switch complex, signaling protein; 2.00A {Thermotoga maritima} Back     alignment and structure
Probab=99.94  E-value=7.5e-24  Score=175.15  Aligned_cols=179  Identities=15%  Similarity=0.137  Sum_probs=167.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCEEEEHHHHHHCCCCCEEEEEEECCCCCCEEEEEECHHHHHHH
Q ss_conf             66799999999999999999999986298079986472566799897116886399999736778339999887899999
Q gi|254780687|r   28 KKTIEKISSSLGYLYKKFLPKIFKEKMDLDVDISYTSCQSGKFSHIIHSFKENFVFSQASLSSWSSNFFIGCSNNLVITL  107 (318)
Q Consensus        28 ~~~~~~~~~~~~e~~~r~l~~~l~~~~~~~v~v~~~~ve~~~~~e~i~~l~~p~~~~i~~~~pl~g~~ll~id~~l~~~l  107 (318)
                      .....++++.++++|++.++..|+++++..+++++ ++++.+|+||++.+++++++.+...++|+|.+++.++.++++.+
T Consensus         5 s~~~l~~L~~i~~~~~~~~~~~L~~ll~~~v~i~v-~i~~~~~~e~~~~~~~~~~v~~~~~~~~~g~~~l~~~~~~~~~l   83 (183)
T 2hp7_A            5 SKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEI-SIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTM   83 (183)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCEEEE-EEEEEEHHHHHHHSCSSCEEEEEEETTCSSCEEEEECHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE-EEEEEEHHHHHHCCCCCEEEEEEEECCCCCEEEEEECHHHHHHH
T ss_conf             46575799999999999999999998588837998-04887699998408997279998605678629999886999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHCHHHHCCCCCCCEEEEEEEE
Q ss_conf             98872788876666665657989999999999999999999851002732000002443110000124787189999988
Q gi|254780687|r  108 LENLLGASHETIPQLYNRSLSTVEKKLAKRTIAQISAVLNQCISTTQESSPNLEDFYDIDYLKKNTNRLSNEFVTTINMN  187 (318)
Q Consensus       108 id~~lGG~g~~~~~~~~R~lT~iE~~l~~~i~~~~~~~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~p~e~vi~i~~~  187 (318)
                      +|+||||.|...   +.|+||++|+++++++++.++.++..+|++..++++.+..++.  +++..+...+++.++.++|+
T Consensus        84 v~~llGg~~~~~---~~~~lt~~E~~~l~ei~n~i~~~~~~~~~~~l~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~  158 (183)
T 2hp7_A           84 LDIIMGGPGENP---PNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVET--NPQFVQIVPPNEIVLLVTAS  158 (183)
T ss_dssp             HHHHHTCC-------CCSCCCHHHHHHHHHHHHHHHHHHHHHTHHHHCCCEEEEEEES--CGGGCCSSCTTSEEEEEEEE
T ss_pred             HHHHCCCCCCCC---CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCHHC--CHHHHCCCCCCCEEEEEEEE
T ss_conf             999748999888---9886758889999999999999999998643446611110212--85765248999849999999


Q ss_pred             EEECCEEEEEEEEEEHHHHHHHHHH
Q ss_conf             6667813799998504775256775
Q gi|254780687|r  188 MTIENVASSFVLIIPQETLLKTTLI  212 (318)
Q Consensus       188 v~~~~~~g~~~l~lP~~~l~~~~~~  212 (318)
                      ++.++..|.+.+|+|++++++++.+
T Consensus       159 i~~~~~~~~~~i~~p~~~l~~l~~k  183 (183)
T 2hp7_A          159 VSWGEFTSFINVCWPFSLLEPLLEK  183 (183)
T ss_dssp             EEETTEEEEEEEEEEHHHHHHHHHC
T ss_pred             EEECCCCEEEEEEEHHHHHHHHCCC
T ss_conf             9989954089998638841534069



>1xkr_A (A:) Chemotaxis protein CHEC; signal transduction, protein phosphatase, attractant; 1.75A {Thermotoga maritima} Back     alignment and structure
>3hzh_B (B:) Chemotaxis operon protein (CHEX); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3h2d_A (A:) CHEC-like superfamily protein; NP_719446.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Shewanella oneidensis mr-1} PDB: 3iic_A* Back     alignment and structure
>3hm4_A (A:) Chemotaxis protein CHEX; YP_386777.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.30A {Desulfovibrio desulfuricans subsp} PDB: 3h4y_A* Back     alignment and structure
>1o9y_A (A:) HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae} Back     alignment and structure
>1o6a_A (A:20-96) Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima} Back     alignment and structure
>1squ_A (A:) CHEX protein; alpha-beta sandwich, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.40A {Thermotoga maritima} Back     alignment and structure