254780688

254780688

putative flagellar motor switch protein

GeneID in NCBI database:8209692Locus tag:CLIBASIA_02875
Protein GI in NCBI database:254780688Protein Accession:YP_003065101.1
Gene range:-(579665, 580108)Protein Length:147aa
Gene description:putative flagellar motor switch protein
COG prediction:[N] [U] Flagellar motor switch/type III secretory pathway protein
KEGG prediction:fliN; putative flagellar motor switch protein; K02417 flagellar motor switch protein FliN/FliY
SEED prediction:putative flagellar motor switch protein
Pathway involved in KEGG:Bacterial chemotaxis [PATH:las02030]
Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNAQ
cccccccEEEEEccccccEEEcccccccHHcccHHccccccccccccccccHHHHHccccccccccccHHHHHcccEEEEEEEccEEEcHHHHHccccccEEEcccccccEEEEEEccEEEEEEEEEEEcccccEEEEEEEEEcccc
ccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccccccccccEEEEccEEEEEEEccccHcHHHHHHHccccEEEEcccccccEEEEEccEEEEEEEEEEEcccccEEEEEEEEEEccc
MIKKVSKISYIKdnlegrsmhidnplqdtnvssptnnsemliqkndvdnisepissdsnnilekstdnfdlimNIPVKMQIILGSCCMqisnlvnlskgdvitldkrvgesvditinnqkiakgeitimeeddthFGVRVIEILNAQ
MIKKVSKISYIKdnlegrsmhidnplQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDkrvgesvditinnqkiakgeitimeeddthfgVRVIEILNAQ
MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNAQ
***KVSK****************************************************************IMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEIL***
MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNAQ
MIKKVSKISYIKDNLEGRSMH****************S***************************TDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNAQ
MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNAQ
MIKKVSKISYIKDNLEGRSMHIDNPLQDTNVSSPTNNSEMLIQKNDVDNISEPISSDSNNILEKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNAQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target147 putative flagellar motor switch protein [Candidatus Lib
315121855136 putative flagellar motor switch protein [Candidatus Lib 1 3e-46
222084856179 flagellar motor switch protein [Agrobacterium radiobact 1 1e-20
116250473195 flagellar motor switch protein [Rhizobium leguminosarum 1 1e-20
241203097194 flagellar motor switch protein FliN [Rhizobium legumino 1 1e-20
86356303214 flagellar motor switch protein [Rhizobium etli CFN 42] 1 2e-20
218508216195 flagellar motor switch protein [Rhizobium etli Brasil 5 1 2e-20
190890354195 flagellar motor switch protein [Rhizobium etli CIAT 652 1 2e-20
222147562220 flagellar motor switch protein FliN [Agrobacterium viti 1 6e-20
209547919195 flagellar motor switch protein FliN [Rhizobium legumino 1 6e-20
218679322178 putative flagellar motor switch protein [Rhizobium etli 1 2e-19
>gi|315121855|ref|YP_004062344.1| putative flagellar motor switch protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 136 Back     alignment and organism information
 Score =  187 bits (476), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/136 (73%), Positives = 114/136 (83%), Gaps = 8/136 (5%)

Query: 20  MHIDNPLQDTNVSSPT---NNSEMLIQ-----KNDVDNISEPISSDSNNILEKSTDNFDL 71
           MHID+PLQD + S      NNS +        +ND+D+ SE ISS+SNNI EKS+DN DL
Sbjct: 1   MHIDSPLQDHDQSEECTLKNNSHIFQNTTENPQNDLDDSSEKISSNSNNIFEKSSDNIDL 60

Query: 72  IMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEE 131
           IMNIPV +QIILGSCCMQISNLVNLSKGDVITLDKRVGE+VDITINNQKIAKGEITIME+
Sbjct: 61  IMNIPVNIQIILGSCCMQISNLVNLSKGDVITLDKRVGEAVDITINNQKIAKGEITIMED 120

Query: 132 DDTHFGVRVIEILNAQ 147
           DDTHFGVRVIE+LN++
Sbjct: 121 DDTHFGVRVIELLNSK 136


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084856|ref|YP_002543385.1| flagellar motor switch protein [Agrobacterium radiobacter K84] Length = 179 Back     alignment and organism information
>gi|116250473|ref|YP_766311.1| flagellar motor switch protein [Rhizobium leguminosarum bv. viciae 3841] Length = 195 Back     alignment and organism information
>gi|241203097|ref|YP_002974193.1| flagellar motor switch protein FliN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 194 Back     alignment and organism information
>gi|86356303|ref|YP_468195.1| flagellar motor switch protein [Rhizobium etli CFN 42] Length = 214 Back     alignment and organism information
>gi|218508216|ref|ZP_03506094.1| flagellar motor switch protein [Rhizobium etli Brasil 5] Length = 195 Back     alignment and organism information
>gi|190890354|ref|YP_001976896.1| flagellar motor switch protein [Rhizobium etli CIAT 652] Length = 195 Back     alignment and organism information
>gi|222147562|ref|YP_002548519.1| flagellar motor switch protein FliN [Agrobacterium vitis S4] Length = 220 Back     alignment and organism information
>gi|209547919|ref|YP_002279836.1| flagellar motor switch protein FliN [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 195 Back     alignment and organism information
>gi|218679322|ref|ZP_03527219.1| putative flagellar motor switch protein [Rhizobium etli CIAT 894] Length = 178 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target147 putative flagellar motor switch protein [Candidatus Lib
TIGR0248077 TIGR02480, fliN, flagellar motor switch protein FliN 8e-15
PRK08119382 PRK08119, PRK08119, flagellar motor switch protein; Val 8e-14
PRK07963137 PRK07963, fliN, flagellar motor switch protein FliN; Va 7e-12
pfam0105277 pfam01052, SpoA, Surface presentation of antigens (SPOA 3e-11
PRK05698155 PRK05698, fliN, flagellar motor switch protein; Validat 1e-09
TIGR02551298 TIGR02551, SpaO_YscQ, type III secretion system apparat 5e-09
PRK08983127 PRK08983, fliN, flagellar motor switch protein; Validat 5e-08
PRK08433111 PRK08433, PRK08433, flagellar motor switch protein; Val 1e-07
PRK06782528 PRK06782, PRK06782, flagellar motor switch protein; Rev 2e-07
PRK06788119 PRK06788, PRK06788, flagellar motor switch protein; Val 2e-06
PRK0603383 PRK06033, PRK06033, hypothetical protein; Validated 3e-05
PRK08432283 PRK08432, PRK08432, flagellar motor switch protein FliY 1e-04
COG1868332 COG1868, FliM, Flagellar motor switch protein [Cell mot 2e-04
PRK06666337 PRK06666, fliM, flagellar motor switch protein FliM; Va 6e-04
PRK08916116 PRK08916, PRK08916, flagellar motor switch protein; Rev 5e-12
COG1886136 COG1886, FliN, Flagellar motor switch/type III secretor 9e-15
>gnl|CDD|131533 TIGR02480, fliN, flagellar motor switch protein FliN Back     alignment and domain information
>gnl|CDD|181236 PRK08119, PRK08119, flagellar motor switch protein; Validated Back     alignment and domain information
>gnl|CDD|181183 PRK07963, fliN, flagellar motor switch protein FliN; Validated Back     alignment and domain information
>gnl|CDD|144589 pfam01052, SpoA, Surface presentation of antigens (SPOA) Back     alignment and domain information
>gnl|CDD|168189 PRK05698, fliN, flagellar motor switch protein; Validated Back     alignment and domain information
>gnl|CDD|162918 TIGR02551, SpaO_YscQ, type III secretion system apparatus protein YscQ/HrcQ Back     alignment and domain information
>gnl|CDD|181603 PRK08983, fliN, flagellar motor switch protein; Validated Back     alignment and domain information
>gnl|CDD|181423 PRK08433, PRK08433, flagellar motor switch protein; Validated Back     alignment and domain information
>gnl|CDD|180692 PRK06782, PRK06782, flagellar motor switch protein; Reviewed Back     alignment and domain information
>gnl|CDD|180693 PRK06788, PRK06788, flagellar motor switch protein; Validated Back     alignment and domain information
>gnl|CDD|180359 PRK06033, PRK06033, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|181422 PRK08432, PRK08432, flagellar motor switch protein FliY; Validated Back     alignment and domain information
>gnl|CDD|32053 COG1868, FliM, Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|180651 PRK06666, fliM, flagellar motor switch protein FliM; Validated Back     alignment and domain information
>gnl|CDD|181582 PRK08916, PRK08916, flagellar motor switch protein; Reviewed Back     alignment and domain information
>gnl|CDD|32070 COG1886, FliN, Flagellar motor switch/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 147 putative flagellar motor switch protein [Candidatus Lib
PRK06782547 flagellar motor switch protein; Reviewed 99.97
PRK08119390 flagellar motor switch protein; Validated 99.97
PRK05698155 fliN flagellar motor switch protein; Validated 99.96
PRK08916114 flagellar motor switch protein; Reviewed 99.96
PRK08432281 flagellar motor switch protein FliY; Validated 99.95
PRK08983126 fliN flagellar motor switch protein; Validated 99.95
TIGR0248077 fliN flagellar motor switch protein FliN; InterPro: IPR 99.95
PRK07963137 fliN flagellar motor switch protein FliN; Validated 99.95
PRK06788119 flagellar motor switch protein; Validated 99.95
PRK08433111 flagellar motor switch protein; Validated 99.94
PRK0603387 hypothetical protein; Validated 99.92
COG1886136 FliN Flagellar motor switch/type III secretory pathway 99.91
PRK06666336 fliM flagellar motor switch protein FliM; Validated 99.79
TIGR02551326 SpaO_YscQ type III secretion apparatus protein, YscQ/Hr 99.79
pfam0105277 SpoA Surface presentation of antigens (SPOA). This fami 99.73
PRK06933307 type III secretion system protein; Validated 99.65
PRK08158303 surface presentation of antigens protein SpaO; Validate 99.65
PRK12795378 fliM flagellar motor switch protein FliM; Reviewed 99.53
COG1868332 FliM Flagellar motor switch protein [Cell motility and 99.4
PRK08035326 type III secretion system protein; Validated 99.28
TIGR01397328 fliM_switch flagellar motor switch protein FliM; InterP 98.08
PRK05933371 type III secretion system protein; Validated 96.81
PRK08158303 surface presentation of antigens protein SpaO; Validate 95.91
PRK05933371 type III secretion system protein; Validated 99.4
PRK0678961 flagellar motor switch protein; Validated 98.14
PRK06933307 type III secretion system protein; Validated 96.06
TIGR02551 326 SpaO_YscQ type III secretion apparatus protein, YscQ/Hr 93.03
>PRK06782 flagellar motor switch protein; Reviewed Back     alignment and domain information
>PRK08119 flagellar motor switch protein; Validated Back     alignment and domain information
>PRK05698 fliN flagellar motor switch protein; Validated Back     alignment and domain information
>PRK08916 flagellar motor switch protein; Reviewed Back     alignment and domain information
>PRK08432 flagellar motor switch protein FliY; Validated Back     alignment and domain information
>PRK08983 fliN flagellar motor switch protein; Validated Back     alignment and domain information
>TIGR02480 fliN flagellar motor switch protein FliN; InterPro: IPR012826 Proteins that consist largely of this domain can be designated flagellar motor switch proteins: FliN Back     alignment and domain information
>PRK07963 fliN flagellar motor switch protein FliN; Validated Back     alignment and domain information
>PRK06788 flagellar motor switch protein; Validated Back     alignment and domain information
>PRK08433 flagellar motor switch protein; Validated Back     alignment and domain information
>PRK06033 hypothetical protein; Validated Back     alignment and domain information
>COG1886 FliN Flagellar motor switch/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06666 fliM flagellar motor switch protein FliM; Validated Back     alignment and domain information
>TIGR02551 SpaO_YscQ type III secretion apparatus protein, YscQ/HrcQ family; InterPro: IPR013385 Proteins in this entry are encoded within type III secretion operons and are involved in many different functions Back     alignment and domain information
>pfam01052 SpoA Surface presentation of antigens (SPOA) Back     alignment and domain information
>PRK06933 type III secretion system protein; Validated Back     alignment and domain information
>PRK08158 surface presentation of antigens protein SpaO; Validated Back     alignment and domain information
>PRK12795 fliM flagellar motor switch protein FliM; Reviewed Back     alignment and domain information
>COG1868 FliM Flagellar motor switch protein [Cell motility and secretion] Back     alignment and domain information
>PRK08035 type III secretion system protein; Validated Back     alignment and domain information
>TIGR01397 fliM_switch flagellar motor switch protein FliM; InterPro: IPR001689 The flagellar motor switch in Escherichia coli and Salmonella typhimurium regulates the direction of flagellar rotation and hence controls swimming behaviour Back     alignment and domain information
>PRK05933 type III secretion system protein; Validated Back     alignment and domain information
>PRK08158 surface presentation of antigens protein SpaO; Validated Back     alignment and domain information
>PRK05933 type III secretion system protein; Validated Back     alignment and domain information
>PRK06789 flagellar motor switch protein; Validated Back     alignment and domain information
>PRK06933 type III secretion system protein; Validated Back     alignment and domain information
>TIGR02551 SpaO_YscQ type III secretion apparatus protein, YscQ/HrcQ family; InterPro: IPR013385 Proteins in this entry are encoded within type III secretion operons and are involved in many different functions Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target147 putative flagellar motor switch protein [Candidatus Lib
1yab_A87 Structure Of T. Maritima Flin Flagellar Rotor Prote 9e-22
1o6a_A96 Crystal Structure Of A C-Terminal Fragment Of The P 2e-20
1o9y_A84 Crystal Structure Of The C-Terminal Domain Of The H 2e-06
>gi|71042010|pdb|1YAB|A Chain A, Structure Of T. Maritima Flin Flagellar Rotor Protein Length = 87 Back     alignment and structure
 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 55/82 (67%), Gaps = 3/82 (3%)

Query: 66  TDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGE 125
           +D  +L+++IP+K+ + LG   M +  ++ +  G +I LDK  GE VDI +N + IA+GE
Sbjct: 1   SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGE 60

Query: 126 ITIMEEDDTHFGVRVIEILNAQ 147
           + +++E   +FGVR+ EI++ +
Sbjct: 61  VVVIDE---NFGVRITEIVSPK 79


>gi|39654324|pdb|1O6A|A Chain A, Crystal Structure Of A C-Terminal Fragment Of The Putative Flagelar Motor Switch Protein Flin (Tm0680) From Thermotoga Maritima At 1.85 A Resolution Length = 96 Back     alignment and structure
>gi|40889181|pdb|1O9Y|A Chain A, Crystal Structure Of The C-Terminal Domain Of The Hrcqb Protein From Pseudomonas Syringae Pv. Phaseolicola Length = 84 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target147 putative flagellar motor switch protein [Candidatus Lib
1o6a_A96 Putative flagelar motor switch protein FLIN; TM0680A, C 5e-15
1o9y_A84 HRCQ2; secretory protein, HRP, type III secretion syste 4e-11
>1o6a_A Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima} SCOP: b.139.1.1 PDB: 1yab_A Length = 96 Back     alignment and structure
 Score = 75.1 bits (185), Expect = 5e-15
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 3/85 (3%)

Query: 63  EKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIA 122
           E  +D  +L+++IP+K+ + LG   M +  ++ +  G +I LDK  GE VDI +N + IA
Sbjct: 7   EVPSDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIA 66

Query: 123 KGEITIMEEDDTHFGVRVIEILNAQ 147
           +GE+ +++E   +FGVR+ EI++ +
Sbjct: 67  RGEVVVIDE---NFGVRITEIVSPK 88


>1o9y_A HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae} SCOP: b.139.1.1 Length = 84 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target147 putative flagellar motor switch protein [Candidatus Lib
1o6a_A96 Putative flagelar motor switch protein FLIN; TM0680A, C 99.8
1o9y_A84 HRCQ2; secretory protein, HRP, type III secretion syste 99.78
>1o6a_A Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima} SCOP: b.139.1.1 PDB: 1yab_A Back     alignment and structure
Probab=99.80  E-value=2.5e-19  Score=128.86  Aligned_cols=80  Identities=38%  Similarity=0.781  Sum_probs=75.1

Q ss_pred             CHHHHHHHCCCCEEEEEEEEEEEECHHHHHCCCCCCEEECCCCCCCCEEEEECCEEEEEEEEEEECCCCCEEEEEEEEEE
Q ss_conf             10002343055138999992134429999457978899847778880699999989999999995688870558999731
Q gi|254780688|r   65 STDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEIL  144 (147)
Q Consensus        65 ~~~~~~~l~dipv~i~veLG~~~i~i~dll~L~~G~Vi~Ld~~~~epV~i~vng~~ia~GElv~v~e~~~~~gvrIt~ii  144 (147)
                      ....++.|+|+||+++|+||+++++++||++|++|+||+|++.++++|+|+|||+++|+|+++.+|+   |+||||++++
T Consensus         9 ~~~~l~~l~di~v~l~~~lg~~~l~l~dl~~L~~Gdvi~l~~~~~~~v~l~v~g~~~~~g~lg~~~~---~~av~I~~~i   85 (96)
T 1o6a_A            9 PSDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDE---NFGVRITEIV   85 (96)
T ss_dssp             -CHHHHHHTTCEEEEEEEEEEEEEEHHHHHHCCTTCEEEEEEETTCCEEEEETTEEEEEEEEEEETT---EEEEEEEEEC
T ss_pred             CHHHHHHHCCCCEEEEEEEEEEEEEHHHHHCCCCCCEEECCCCCCCCEEEEECCEEEEEEEEEEECC---EEEEEEEEEC
T ss_conf             7024466326608999999510856999846899999991798999789999999999999999999---9999999841


Q ss_pred             CCC
Q ss_conf             679
Q gi|254780688|r  145 NAQ  147 (147)
Q Consensus       145 s~~  147 (147)
                      +++
T Consensus        86 ~~~   88 (96)
T 1o6a_A           86 SPK   88 (96)
T ss_dssp             CHH
T ss_pred             CCH
T ss_conf             948



>1o9y_A HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae} SCOP: b.139.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 147 putative flagellar motor switch protein [Candidatus Lib
d1o6aa_87 b.139.1.1 (A:) Putative flagelar motor switch protein F 3e-15
d1o9ya_71 b.139.1.1 (A:) Structural protein HrcQ2, C-terminal dom 2e-11
>d1o6aa_ b.139.1.1 (A:) Putative flagelar motor switch protein FliN {Thermotoga maritima [TaxId: 2336]} Length = 87 Back     information, alignment and structure

class: All beta proteins
fold: Surface presentation of antigens (SPOA)
superfamily: Surface presentation of antigens (SPOA)
family: Surface presentation of antigens (SPOA)
domain: Putative flagelar motor switch protein FliN
species: Thermotoga maritima [TaxId: 2336]
 Score = 75.0 bits (185), Expect = 3e-15
 Identities = 30/82 (36%), Positives = 55/82 (67%), Gaps = 3/82 (3%)

Query: 66  TDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGE 125
           +D  +L+++IP+K+ + LG   M +  ++ +  G +I LDK  GE VDI +N + IA+GE
Sbjct: 1   SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGE 60

Query: 126 ITIMEEDDTHFGVRVIEILNAQ 147
           + +++E   +FGVR+ EI++ +
Sbjct: 61  VVVIDE---NFGVRITEIVSPK 79


>d1o9ya_ b.139.1.1 (A:) Structural protein HrcQ2, C-terminal domain {Pseudomonas syringae [TaxId: 317]} Length = 71 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target147 putative flagellar motor switch protein [Candidatus Lib
d1o6aa_87 Putative flagelar motor switch protein FliN {Thermotoga 99.78
d1o9ya_71 Structural protein HrcQ2, C-terminal domain {Pseudomona 99.77
>d1o6aa_ b.139.1.1 (A:) Putative flagelar motor switch protein FliN {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All beta proteins
fold: Surface presentation of antigens (SPOA)
superfamily: Surface presentation of antigens (SPOA)
family: Surface presentation of antigens (SPOA)
domain: Putative flagelar motor switch protein FliN
species: Thermotoga maritima [TaxId: 2336]
Probab=99.78  E-value=3.5e-19  Score=126.73  Aligned_cols=77  Identities=39%  Similarity=0.797  Sum_probs=73.6

Q ss_pred             HHHHHHCCCCEEEEEEEEEEEECHHHHHCCCCCCEEECCCCCCCCEEEEECCEEEEEEEEEEECCCCCEEEEEEEEEECC
Q ss_conf             00234305513899999213442999945797889984777888069999998999999999568887055899973167
Q gi|254780688|r   67 DNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILNA  146 (147)
Q Consensus        67 ~~~~~l~dipv~i~veLG~~~i~i~dll~L~~G~Vi~Ld~~~~epV~i~vng~~ia~GElv~v~e~~~~~gvrIt~iis~  146 (147)
                      .+++.++|+|++++|+||++++++++|++|++||||+|++.++++++++|||+++|+|+++.+|+   ++||||+++++.
T Consensus         2 ~~l~~i~dipv~l~~~Lg~~~l~l~el~~L~~Gdvi~L~~~~~~~v~l~v~g~~~~~g~lg~~~~---~~av~I~~~i~~   78 (87)
T d1o6aa_           2 DKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDE---NFGVRITEIVSP   78 (87)
T ss_dssp             HHHHHHTTCEEEEEEEEEEEEEEHHHHHHCCTTCEEEEEEETTCCEEEEETTEEEEEEEEEEETT---EEEEEEEEECCH
T ss_pred             CCHHHHCCCCEEEEEEEEEEEEEHHHHHCCCCCCEEEECCCCCCCEEEEECCEEEEEEEEEEECC---EEEEEEEEECCC
T ss_conf             43023326717999999300845999857999999991898999799999999999999999999---999999981595



>d1o9ya_ b.139.1.1 (A:) Structural protein HrcQ2, C-terminal domain {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 147 putative flagellar motor switch protein [Candidatu
1o9y_A_84 (A:) HRCQ2; secretory protein, HRP, type III secre 9e-14
1o6a_A_20-9677 (A:20-96) Putative flagelar motor switch protein F 1e-10
>1o9y_A (A:) HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae}Length = 84 Back     alignment and structure
 Score = 70.5 bits (173), Expect = 9e-14
 Identities = 11/83 (13%), Positives = 33/83 (39%), Gaps = 3/83 (3%)

Query: 63  EKSTDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIA 122
               D    + ++ + + +  G   + ++ L  L  G ++ +         +    Q +A
Sbjct: 3   MDPQDEPPALDSLALDLTLRCGELRLTLAELRRLDAGTILEVTGISPGHATLCHGEQVVA 62

Query: 123 KGEITIMEEDDTHFGVRVIEILN 145
           +GE+  +E      G+++  ++ 
Sbjct: 63  EGELVDVEG---RLGLQITRLVT 82


>1o6a_A (A:20-96) Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima}Length = 77 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target147 putative flagellar motor switch protein [Candidatus Lib
1o9y_A_84 HRCQ2; secretory protein, HRP, type III secretion 99.73
1o6a_A_20-9677 Putative flagelar motor switch protein FLIN; TM068 99.67
>1o9y_A (A:) HRCQ2; secretory protein, HRP, type III secretion system, phytopathogenicity; 2.29A {Pseudomonas syringae} Back     alignment and structure
Probab=99.73  E-value=4.7e-17  Score=116.79  Aligned_cols=78  Identities=14%  Similarity=0.320  Sum_probs=72.8

Q ss_pred             HHHHHHHCCCCEEEEEEEEEEEECHHHHHCCCCCCEEECCCCCCCCEEEEECCEEEEEEEEEEECCCCCEEEEEEEEEEC
Q ss_conf             00023430551389999921344299994579788998477788806999999899999999956888705589997316
Q gi|254780688|r   66 TDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGEITIMEEDDTHFGVRVIEILN  145 (147)
Q Consensus        66 ~~~~~~l~dipv~i~veLG~~~i~i~dll~L~~G~Vi~Ld~~~~epV~i~vng~~ia~GElv~v~e~~~~~gvrIt~iis  145 (147)
                      .+....+.++|++++++||++++++++|++|++||||+|++.+.++|++++||+++|+|+++.+|.   +|||||+++++
T Consensus         6 ~~l~~~l~~~~v~l~~~l~~~~l~l~el~~L~~Gdvi~l~~~~~~~v~l~v~g~~~~~g~lg~~~~---~~av~I~~~i~   82 (84)
T 1o9y_A            6 QDEPPALDSLALDLTLRCGELRLTLAELRRLDAGTILEVTGISPGHATLCHGEQVVAEGELVDVEG---RLGLQITRLVT   82 (84)
T ss_dssp             -----CCTTCEEEEEEEEEEEEEEHHHHHTCCTTCEEEECSSCTTEEEEEETTEEEEEEEEEEETT---EEEEEEEEEC-
T ss_pred             CCCHHHHHCCCEEEEEEEECCEEEHHHHHCCCCCCEEEECCCCCCCEEEEECCEEEEEEEEEEECC---EEEEEEEEEEE
T ss_conf             126557726847999999013857999951899999990777899899999889999997999999---99999999000


Q ss_pred             C
Q ss_conf             7
Q gi|254780688|r  146 A  146 (147)
Q Consensus       146 ~  146 (147)
                      .
T Consensus        83 ~   83 (84)
T 1o9y_A           83 R   83 (84)
T ss_dssp             -
T ss_pred             C
T ss_conf             7



>1o6a_A (A:20-96) Putative flagelar motor switch protein FLIN; TM0680A, C- terminal proteolytic fragment of TM0680A, structural genomics, JCSG, PSI; 1.85A {Thermotoga maritima} Back     alignment and structure