254780696

254780696

glutathione synthetase

GeneID in NCBI database:8209700Locus tag:CLIBASIA_02915
Protein GI in NCBI database:254780696Protein Accession:YP_003065109.1
Gene range:-(571665, 572615)Protein Length:316aa
Gene description:glutathione synthetase
COG prediction:[H] [J] Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase)
KEGG prediction:gshB; glutathione synthetase (EC:6.3.2.3); K01920 glutathione synthase [EC:6.3.2.3]
SEED prediction:Glutathione synthetase (EC 6.3.2.3)
Pathway involved in KEGG:Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Glutathione: Biosynthesis and gamma-glutamyl cycle;
Glutaredoxins;
Heat shock dnaK gene cluster extended;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKET
ccccEEEEEEEccHHHcccccccHHHHHHHHHHcccEEEEEEHHHcEEccccccccEEEEEEEccccccEEccccccccHHHccEEEEcccccccHHHHHHHHHHHHcccccEEEccHHHHHHccHHHHHHHHHccccccEEEccHHHHHHHHHHcccEEEEEccccccEEEEEEccccHHHHHHHHHHHHcccccEEEEccccccccccEEEEEEccEEEEEEEEEcccccEEEEEEcccEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEccEEEEEccccccHHHHHHHHccccHHHHHHHHHHHHHcc
ccccEEEEEEcccHHHccccccHHHHHHHHHHHcccEEEEEcHHHEEEEccEEEEEEEEEEEcccccccEEEEEEEEEEHHHccEEEEcccccccHHHHHHHHHHHHHHHcccEEEcHHHHHHccccHHHHHHccccccEEEEccHHHHHHHHHHHccEEEEccccccccccEEEccccccHHHHHHHHcccccccEEEEEccHHHHHcEEEEEEEccEEcccHcEEcccccccccHHHccEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEccccccHHHHHHHccccHHHHHHHHHHHHHcc
MKKIRNIAIQMNhistvkvkedSTFAIALEAQVRGyqifhytpdqlymrdskiyantqplsldeKKEQYYSLgeekiidlsQMDVILirqdppfnmhyITSTYLlekinpetlivnnpfwirnspekiFVTEfselmpptlisrdITQITRFYLEMKDIiikplygnggtgvfritlgdrNFSSLIEMLFekypeplmiqsylpqirdgdkrilllngkpvgavnripsevdnrsnihaggkaeltklTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEinvtsptcireihrnggenvASLFWDGIEKIKET
mkkirniaiqmnhistvkvkeDSTFAIALEAQVRGYQIFHYtpdqlymrDSKIYantqplsldEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFselmpptlisrDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPvgavnripsevdnrsnihaggkaeltkltkidLDICKRIGeslrerglfftgIDVIGDYITEINVTSPTCIREihrnggenvaslfwdgiekiket
MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKET
***IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIK**
MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKET
**KIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKET
MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKET
MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAGGKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKET

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target316 glutathione synthetase [Candidatus Liberibacter asiatic
315121861319 glutathione synthetase [Candidatus Liberibacter solanac 1 1e-147
325291744319 glutathione synthetase [Agrobacterium sp. H13-3] Length 1 1e-118
159184250319 glutathione synthetase [Agrobacterium tumefaciens str. 1 1e-118
150398730315 glutathione synthetase [Sinorhizobium medicae WSM419] L 1 1e-118
222147290315 glutathione synthetase [Agrobacterium vitis S4] Length 1 1e-117
15964091315 glutathione synthetase [Sinorhizobium meliloti 1021] Le 1 1e-116
222084604315 glutathione synthase [Agrobacterium radiobacter K84] Le 1 1e-115
227824184315 glutathione synthetase [Sinorhizobium fredii NGR234] Le 1 1e-114
19550898315 glutathione synthetase [Rhizobium tropici] Length = 315 1 1e-114
241207281315 glutathione synthetase [Rhizobium leguminosarum bv. tri 1 1e-114
>gi|315121861|ref|YP_004062350.1| glutathione synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 319 Back     alignment and organism information
 Score =  524 bits (1349), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 250/312 (80%), Positives = 287/312 (91%)

Query: 1   MKKIRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPL 60
           M KI NIAIQM+HIST+  KEDSTFAIALEAQ+RG QIFHYTPDQL++R++KIYA  +PL
Sbjct: 1   MIKISNIAIQMDHISTINPKEDSTFAIALEAQIRGSQIFHYTPDQLFIRENKIYAYVEPL 60

Query: 61  SLDEKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW 120
            L + +E YYSL E+++++LSQMDVILIRQ+PPFNMHYIT+TYLLEKIN +TLI+NNPFW
Sbjct: 61  FLYDNQENYYSLREKQLVNLSQMDVILIRQNPPFNMHYITNTYLLEKINSKTLILNNPFW 120

Query: 121 IRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDR 180
           IRNSPEKIFVTEFSELMPPTLISRDI QIT+FYLEMKDIIIKPLYGNGG GVFRIT  DR
Sbjct: 121 IRNSPEKIFVTEFSELMPPTLISRDIPQITKFYLEMKDIIIKPLYGNGGNGVFRITPEDR 180

Query: 181 NFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEVDNRSNIHAG 240
           NFSSLIE+LF+KYPEPL+IQSYLPQ+R+GDKRILLL+GKPVGA+NRIPSE DNRSNIHAG
Sbjct: 181 NFSSLIEILFDKYPEPLIIQSYLPQVRNGDKRILLLDGKPVGAINRIPSEKDNRSNIHAG 240

Query: 241 GKAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGE 300
           GKAELT+LT  + DIC RIG SL+ERGLFFTGIDVIG+YITEINVTSPTCIREI+++GG 
Sbjct: 241 GKAELTELTNREKDICHRIGPSLQERGLFFTGIDVIGNYITEINVTSPTCIREIYKHGGN 300

Query: 301 NVASLFWDGIEK 312
           N+ASLFWD +E+
Sbjct: 301 NIASLFWDAVEE 312


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291744|ref|YP_004277608.1| glutathione synthetase [Agrobacterium sp. H13-3] Length = 319 Back     alignment and organism information
>gi|159184250|ref|NP_353341.2| glutathione synthetase [Agrobacterium tumefaciens str. C58] Length = 319 Back     alignment and organism information
>gi|150398730|ref|YP_001329197.1| glutathione synthetase [Sinorhizobium medicae WSM419] Length = 315 Back     alignment and organism information
>gi|222147290|ref|YP_002548247.1| glutathione synthetase [Agrobacterium vitis S4] Length = 315 Back     alignment and organism information
>gi|15964091|ref|NP_384444.1| glutathione synthetase [Sinorhizobium meliloti 1021] Length = 315 Back     alignment and organism information
>gi|222084604|ref|YP_002543133.1| glutathione synthase [Agrobacterium radiobacter K84] Length = 315 Back     alignment and organism information
>gi|227824184|ref|YP_002828157.1| glutathione synthetase [Sinorhizobium fredii NGR234] Length = 315 Back     alignment and organism information
>gi|19550898|gb|AAL91575.1| glutathione synthetase [Rhizobium tropici] Length = 315 Back     alignment and organism information
>gi|241207281|ref|YP_002978377.1| glutathione synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 315 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target316 glutathione synthetase [Candidatus Liberibacter asiatic
PRK05246316 PRK05246, PRK05246, glutathione synthetase; Provisional 1e-142
TIGR01380312 TIGR01380, glut_syn, glutathione synthetase, prokaryoti 1e-102
COG0189318 COG0189, RimK, Glutathione synthase/Ribosomal protein S 2e-61
PRK12458338 PRK12458, PRK12458, glutathione synthetase; Provisional 1e-50
pfam02951119 pfam02951, GSH-S_N, Prokaryotic glutathione synthetase, 9e-46
TIGR00768277 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK fa 2e-11
TIGR02144280 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX 3e-04
pfam08443190 pfam08443, RimK, RimK-like ATP-grasp domain 9e-11
PRK14016 727 PRK14016, PRK14016, cyanophycin synthetase; Provisional 1e-04
TIGR02068 864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 3e-04
pfam02955176 pfam02955, GSH-S_ATP, Prokaryotic glutathione synthetas 1e-75
PRK10446300 PRK10446, PRK10446, ribosomal protein S6 modification p 2e-06
>gnl|CDD|179971 PRK05246, PRK05246, glutathione synthetase; Provisional Back     alignment and domain information
>gnl|CDD|130447 TIGR01380, glut_syn, glutathione synthetase, prokaryotic Back     alignment and domain information
>gnl|CDD|30538 COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183536 PRK12458, PRK12458, glutathione synthetase; Provisional Back     alignment and domain information
>gnl|CDD|145876 pfam02951, GSH-S_N, Prokaryotic glutathione synthetase, N-terminal domain Back     alignment and domain information
>gnl|CDD|162031 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX Back     alignment and domain information
>gnl|CDD|117020 pfam08443, RimK, RimK-like ATP-grasp domain Back     alignment and domain information
>gnl|CDD|184454 PRK14016, PRK14016, cyanophycin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|111803 pfam02955, GSH-S_ATP, Prokaryotic glutathione synthetase, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|182468 PRK10446, PRK10446, ribosomal protein S6 modification protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 316 glutathione synthetase [Candidatus Liberibacter asiatic
TIGR01380322 glut_syn glutathione synthase; InterPro: IPR006284 Thes 100.0
PRK05246316 glutathione synthetase; Provisional 100.0
PRK12458349 glutathione synthetase; Provisional 100.0
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 100.0
PRK10446300 ribosomal protein S6 modification protein; Provisional 100.0
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 100.0
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 100.0
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 99.85
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.73
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 99.72
PRK02186 892 argininosuccinate lyase; Provisional 99.67
PRK07206415 hypothetical protein; Provisional 99.6
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 99.59
COG2232389 Predicted ATP-dependent carboligase related to biotin c 99.49
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 99.4
pfam05770307 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase 99.21
PRK08462 446 biotin carboxylase; Validated 99.14
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 99.11
PRK07178 471 acetyl-CoA carboxylase; Validated 99.1
PRK12833 458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 99.1
PRK05586 447 biotin carboxylase; Validated 98.99
PRK06111 449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 98.9
PRK08654 497 pyruvate carboxylase subunit A; Validated 98.89
PRK08591 449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 98.87
PRK12999 1147 pyruvate carboxylase; Reviewed 98.8
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 98.79
PRK08463 478 acetyl-CoA carboxylase; Validated 98.78
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 98.78
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 98.73
PRK00885 424 phosphoribosylamine--glycine ligase; Provisional 98.68
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 98.62
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 98.55
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 98.54
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 98.52
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 98.45
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 98.04
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 97.44
pfam02955176 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp 100.0
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 100.0
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.91
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 99.85
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 99.55
TIGR02291320 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterP 99.54
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 99.54
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 99.33
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 99.2
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 99.08
pfam02750203 Synapsin_C Synapsin, ATP binding domain. Ca dependent A 98.89
COG3919415 Predicted ATP-grasp enzyme [General function prediction 98.19
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 98.17
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 97.72
KOG0369 1176 consensus 97.67
KOG0238 670 consensus 97.6
KOG0370 1435 consensus 97.27
KOG0237 788 consensus 97.16
TIGR00514 451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 96.74
PRK06524 480 biotin carboxylase-like protein; Validated 96.7
KOG0368 2196 consensus 91.62
pfam02951119 GSH-S_N Prokaryotic glutathione synthetase, N-terminal 100.0
PRK06849387 hypothetical protein; Provisional 99.55
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 99.28
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 98.99
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 98.66
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 98.61
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 94.13
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) 99.43
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 99.35
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 98.62
KOG3895488 consensus 98.6
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877 459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 98.54
COG0151 428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 98.41
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 98.37
PRK05784 485 phosphoribosylamine--glycine ligase; Provisional 98.32
pfam03133291 TTL Tubulin-tyrosine ligase family. Tubulins and microt 98.86
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 98.58
KOG2156 662 consensus 96.34
KOG2158 565 consensus 91.82
KOG2157 497 consensus 90.55
COG2308488 Uncharacterized conserved protein [Function unknown] 98.63
pfam03738372 GSP_synth Glutathionylspermidine synthase. This region 97.77
PHA02117395 glutathionylspermidine synthase domain-containing prote 97.74
COG0754387 Gsp Glutathionylspermidine synthase [Amino acid transpo 97.44
PRK10507619 bifunctional glutathionylspermidine amidase/glutathiony 95.7
pfam04174145 DUF407 Domain of unknown function (DUF407). 98.05
pfam08886404 GshA Glutamate-cysteine ligase. This is a rare family o 94.16
KOG1057 1018 consensus 96.44
>TIGR01380 glut_syn glutathione synthase; InterPro: IPR006284 These are the glutathione synthetases found in Gram-negative bacteria Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family; InterPro: IPR004666 Escherichia coli RimK adds additional Glu residues to the native Glu-Glu C-terminus of ribosomal protein S6 Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IPR011870 The family of proteins found in this family include the characterised LysX from Thermus thermophilus which is part of a well-organised lysine biosynthesis gene cluster Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: IPR005905 D-alanine--D-alanine ligase (6 Back     alignment and domain information
>pfam05770 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK07178 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>pfam02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain Back     alignment and domain information
>pfam08443 RimK RimK-like ATP-grasp domain Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>pfam02655 ATP-grasp_3 ATP-grasp domain Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterPro: IPR011758 Members of this protein family contain a region of homology to the RimK family of alpha-L-glutamate ligases (IPR004666 from INTERPRO), various members of which modify the Glu-Glu C-terminus of ribosomal protein S6, or tetrahydromethanopterin, or a form of coenzyme F420 derivative Back     alignment and domain information
>pfam07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus Back     alignment and domain information
>pfam01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>pfam02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>pfam02222 ATP-grasp ATP-grasp domain Back     alignment and domain information
>pfam02750 Synapsin_C Synapsin, ATP binding domain Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>pfam02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, ATPase subunit; InterPro: IPR005875 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2; InterPro: IPR005862 The formation of isosinate, a precursor of adenylate and guanylate, from 5-phosphoribosyl 1-pyrophosphate in the de novo purine biosynthesis pathway is basically composed of 10 steps of reactions Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG3895 consensus Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>pfam03133 TTL Tubulin-tyrosine ligase family Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>KOG2156 consensus Back     alignment and domain information
>KOG2158 consensus Back     alignment and domain information
>KOG2157 consensus Back     alignment and domain information
>COG2308 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam03738 GSP_synth Glutathionylspermidine synthase Back     alignment and domain information
>PHA02117 glutathionylspermidine synthase domain-containing protein Back     alignment and domain information
>COG0754 Gsp Glutathionylspermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10507 bifunctional glutathionylspermidine amidase/glutathionylspermidine synthetase; Provisional Back     alignment and domain information
>pfam04174 DUF407 Domain of unknown function (DUF407) Back     alignment and domain information
>pfam08886 GshA Glutamate-cysteine ligase Back     alignment and domain information
>KOG1057 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target316 glutathione synthetase [Candidatus Liberibacter asiatic
1gsa_A316 Structure Of Glutathione Synthetase Complexed With 5e-81
1glv_A303 Three-Dimensional Structure Of The Glutathione Synt 7e-77
gi|157831252|pdb|1GSA|A Chain A, Structure Of Glutathione Synthetase Complexed With Adp And Glutathione Length = 316 Back     alignment and structure
 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/314 (41%), Positives = 202/314 (64%), Gaps = 2/314 (0%)

Query: 4   IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLD 63
           +  + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ 
Sbjct: 1   MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK 60

Query: 64  EKKEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEK-INPETLIVNNPFWIR 122
           +  E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+     TLIVN P  +R
Sbjct: 61  QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR 120

Query: 123 NSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNF 182
           +  EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N 
Sbjct: 121 DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL 180

Query: 183 SSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV-NRIPSEVDNRSNIHAGG 241
             + E L E      M Q+YLP I+DGDKR+L+++G+PV     RIP   + R N+ AGG
Sbjct: 181 GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG 240

Query: 242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGEN 301
           + E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      +
Sbjct: 241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS 300

Query: 302 VASLFWDGIEKIKE 315
           +  +  D IE   +
Sbjct: 301 ITGMLMDAIEARLQ 314


>gi|157831205|pdb|1GLV|A Chain A, Three-Dimensional Structure Of The Glutathione Synthetase From Escherichia Coli B At 2.0 Angstroms Resolution Length = 303 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target316 glutathione synthetase [Candidatus Liberibacter asiatic
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GTT; 2.00A {Es 2e-75
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release, sch 4e-11
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pa 2e-05
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (II) IO 1e-16
3df7_A305 Putative ATP-grAsp superfamily protein; putative protei 1e-05
2io8_A619 Bifunctional glutathionylspermidine synthetase/amidase; 0.003
>1gsa_A Glutathione synthetase; ligase; HET: ADP GTT; 2.00A {Escherichia coli B} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Length = 316 Back     alignment and structure
 Score =  277 bits (710), Expect = 2e-75
 Identities = 127/309 (41%), Positives = 200/309 (64%), Gaps = 2/309 (0%)

Query: 6   NIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEK 65
            + I M+ I+ + +K+DS+FA+ LEAQ RGY++ +     LY+ + +  A+T+ L++ + 
Sbjct: 3   KLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQN 62

Query: 66  KEQYYSLGEEKIIDLSQMDVILIRQDPPFNMHYITSTYLLEKINPETLIV-NNPFWIRNS 124
            E+++S   E+ + L+ +DVIL+R+DPPF+  +I +TY+LE+   +  ++ N P  +R+ 
Sbjct: 63  YEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDC 122

Query: 125 PEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIKPLYGNGGTGVFRITLGDRNFSS 184
            EK+F   FS+L P TL++R+  Q+  F+ +  DII+KPL G GG  +FR+  GD N   
Sbjct: 123 NEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNLGV 182

Query: 185 LIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG-AVNRIPSEVDNRSNIHAGGKA 243
           + E L E      M Q+YLP I+DGDKR+L+++G+PV   + RIP   + R N+ AGG+ 
Sbjct: 183 IAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGGRG 242

Query: 244 ELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVA 303
           E   LT+ D  I ++IG +L+E+GL F G+D+IGD +TEINVTSPTCIREI      ++ 
Sbjct: 243 EPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSIT 302

Query: 304 SLFWDGIEK 312
            +  D IE 
Sbjct: 303 GMLMDAIEA 311


>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle transport, structural genomics, structural genomics consortium, SGC; HET: ANP; 1.90A {Homo sapiens} Length = 344 Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Length = 280 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Length = 305 Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A Length = 619 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target316 glutathione synthetase [Candidatus Liberibacter asiatic
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GTT; 2.00A {Es 100.0
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release, sch 100.0
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pa 100.0
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptide; 1. 99.97
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kinase, I 99.95
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphor 99.8
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus 99.77
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine l 99.73
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori 99.71
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2.00A { 99.71
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synthetas 99.67
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp 99.66
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein VANA; 99.66
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syntheta 99.65
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_00538348. 99.6
3ouz_A 446 Biotin carboxylase; structural genomics, center for str 99.5
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglycinami 99.49
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase subunit 99.44
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A 99.41
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 99.38
2yw2_A 424 Phosphoribosylamine--glycine ligase; glycinamide ribonu 99.38
2ip4_A 417 PURD, phosphoribosylamine--glycine ligase; GAR syntheta 99.25
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, bio 99.25
2yrx_A 451 Phosphoribosylglycinamide synthetase; glycinamide ribon 99.19
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine biosy 99.19
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amidotran 99.03
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferase 2, 99.01
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesity, di 98.99
2w70_A 449 Biotin carboxylase; ligase, inhibitor, ATP-binding, fat 98.93
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis 98.82
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, structural 98.77
3mjf_A 431 Phosphoribosylamine--glycine ligase; structural genomic 98.77
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase subunit 98.55
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (II) IO 99.96
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosp 99.69
3df7_A305 Putative ATP-grAsp superfamily protein; putative protei 99.66
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} 99.45
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, 99.14
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative spli 99.03
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, altern 99.01
2qk4_A 452 Trifunctional purine biosynthetic protein adenosine-3; 98.98
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknown fun 99.19
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofura 99.05
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin carboxyl 99.15
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amidotran 98.96
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein compl 98.74
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi-funct 98.63
3n6x_A474 Putative glutathionylspermidine synthase; domain of unk 98.92
2io8_A619 Bifunctional glutathionylspermidine synthetase/amidase; 98.04
2vob_A652 Trypanothione synthetase; ligase; 2.3A {Leishmania majo 97.72
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondrial; P 97.42
1wr2_A238 Hypothetical protein PH1789; structural genomics, NPPSF 92.64
3k1t_A432 Glutamate--cysteine ligase GSHA; putative gamma-glutamy 95.36
>1gsa_A Glutathione synthetase; ligase; HET: ADP GTT; 2.00A {Escherichia coli B} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
Probab=100.00  E-value=0  Score=622.96  Aligned_cols=312  Identities=42%  Similarity=0.740  Sum_probs=300.5

Q ss_pred             CCEEEEEECCHHHCCCCCCCHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCCCCEEEECCCCCCCHHHC
Q ss_conf             33189970998884847646799999999889889999541248999899999999998077741265046443521006
Q gi|254780696|r    4 IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQM   83 (316)
Q Consensus         4 ~~kI~fimDpi~~i~~~~DTT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~~~~f~~~~~~~~~L~~f   83 (316)
                      ||||||||||+++++|++|||++||+|||+|||++||++|+||++.+++++|.++++++.++...||....+...+|++|
T Consensus         1 mmki~fvmDpi~~i~~~~DTT~~L~~eA~kRGhev~~~~~~dL~i~~~~v~a~~~~v~~~~~~~~~~~~~~~~~~~l~~~   80 (316)
T 1gsa_A            1 MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADL   80 (316)
T ss_dssp             CCEEEEECSCGGGCCTTTCHHHHHHHHHHHTTCEEEEECGGGEEEETTEEEEEEEEEEECSCSSCCEEEEEEEEEEGGGS
T ss_pred             CCEEEEEECCHHHCCCCCCHHHHHHHHHHHCCCEEEEEECCCEEEECCEEEEEEEEEEECCCCCCCCCCCCCCEECHHHC
T ss_conf             93899993787876987766999999999879979998104289999999999999997168664222242102131227


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHCCCHHHHHHHHHHCCCCEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             366883288622479999999986235-8504117488752565034334543044310003724556888852143311
Q gi|254780696|r   84 DVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIK  162 (316)
Q Consensus        84 D~i~iR~dPp~d~~yi~~~~~Le~~~~-~~~viN~p~~i~~~~eKl~~~~~~~~~P~T~vt~~~~~~~~f~~~~~~vViK  162 (316)
                      |+||+|+|||||+.|++.+++|+.++. ++.|+|+|.++++++||+++++|++++|+|+++++.+++.+|+++++++|+|
T Consensus        81 D~I~~R~dPp~d~~y~~~~~~L~~~~~~gv~viN~~~ai~~~~~Kl~~~~~~~~~p~T~v~~~~~~~~~~~~~~~~~V~K  160 (316)
T 1gsa_A           81 DVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILK  160 (316)
T ss_dssp             SEEEECCCCCCCHHHHHHHHHHHHHHHTTCEEESCHHHHHHCCTTGGGGGGTTTSCCEEEESCHHHHHHHHHHHSSEEEE
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHCCCCCCC
T ss_conf             43678846997678888878876513478510287799987677777764246789953763566659999714662112


Q ss_pred             CCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECCEEEE-EEEEECCCCCCCCCCCCCC
Q ss_conf             168854344687448871158899999840013340021053445682699998998863-2122045686000000147
Q gi|254780696|r  163 PLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG-AVNRIPSEVDNRSNIHAGG  241 (316)
Q Consensus       163 Pl~g~~G~gV~~i~~~~~~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv~vi~g~~v~-a~~R~~~~~~~r~Nl~~Gg  241 (316)
                      |++|+||+||++++..+.+.....+.....+..++++|+|++++.+||+||+|+||++++ +++|.|++||||+|+|+||
T Consensus       161 pl~g~~G~Gv~~i~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~~~~D~Rv~vi~g~v~~a~~~r~~~~~~~r~N~~~Gg  240 (316)
T 1gsa_A          161 PLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG  240 (316)
T ss_dssp             CSSCCTTTTCEEECTTCTTHHHHHHHHTTTTTSCEEEEECCGGGGGCEEEEEEETTEECSEEEEEECCSSCSCCCGGGTC
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEEEEHHHCCCCEEEEEECCEEEEEEEEEECCCCCHHHHHHCCC
T ss_conf             25678888847981487036889998764067752789985230688369999999987899995068875321000697


Q ss_pred             CEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEEECCEEEEEECCCCHHHHHHHHHCCCCHHHHHHHHHHHHHC
Q ss_conf             31110077899999999999999849879999511787889836883037889975199989999999988633
Q gi|254780696|r  242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKE  315 (316)
Q Consensus       242 ~~~~~~lt~~~~~i~~~~~~~L~~~gl~~~GiDiig~~i~EvNvtsP~g~~~~~~~~~~~i~~~i~d~ie~~~~  315 (316)
                      +++++++|++++++|.++++.|++.||+|||||+||+|++|||+|||+||+++++++|+|+|+.+||++|+..+
T Consensus       241 ~~~~~~l~~~~~~~~~~~~~~l~~~gl~~~GvDiig~~~~EvNv~sp~g~~~i~~~~g~~ia~~i~~~~~~k~~  314 (316)
T 1gsa_A          241 RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVSITGMLMDAIEARLQ  314 (316)
T ss_dssp             EEEEEECCHHHHHHHHHHHHHHHHTTCCEEEEEEETTEEEEEECSSCCCHHHHHHHSSCCHHHHHHHHHHHHTC
T ss_pred             EEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCEEEEEECCCCHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             67872589789999999999998759989999875888899978895779999988698999999999999974



>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle transport, structural genomics, structural genomics consortium, SGC; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4- 5/6-kinase, inositol phosphate, inositolphosphate, polyphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 2i80_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase, RV2981C, structural genomics, TB structural genomics consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori SS1} Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein VANA; ligase, cell WALL, antibiotic resistance, membrane, plasmid; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, ATP-binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, structural genomics; 2.00A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide formyl transferase; purine ribonucleotide biosynthesis, PURT; HET: ADP; 1.70A {Pyrococcus horikoshii OT3} PDB: 2czg_A* Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding, purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotide, structural genomics, NPPSFA; 2.80A {Thermus thermophilus HB8} Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, inhibitor, ATP-binding, fatty acid biosynthesis, nucleotide-binding, lipid synthesis, ATP-grAsp domain; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 1dv2_A* 2gps_A 2gpw_A 3g8c_A* ... Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP, structural genomics; HET: ATP; 2.50A {Thermococcus kodakarensis KOD1} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure