254780697

254780697

large conductance mechanosensitive channel protein

GeneID in NCBI database:8209701Locus tag:CLIBASIA_02920
Protein GI in NCBI database:254780697Protein Accession:YP_003065110.1
Gene range:+(571137, 571562)Protein Length:141aa
Gene description:large conductance mechanosensitive channel protein
COG prediction:[M] Large-conductance mechanosensitive channel
KEGG prediction:mscL; large conductance mechanosensitive channel protein; K03282 large conductance mechanosensitive channel
SEED prediction:Large-conductance mechanosensitive channel
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Potassium homeostasis;
Glutathione-regulated potassium-efflux system and associated functions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN
cccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHEEEEccccccccEEEEccccccccHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcc
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVgcvmgngtdfsnyflpLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKqtenvknppaeVQLLTEIRDLLQKN
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQtenvknppaevqLLTEIRDLLQKN
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPlsseikssliseARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN
****TPV**EFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFM*****************QLLTEIRDLLQ**
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN
***GTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN
MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target141 large conductance mechanosensitive channel protein [Can
315121862140 large conductance mechanosensitive channel protein [Can 1 5e-53
241203007145 large-conductance mechanosensitive channel [Rhizobium l 1 2e-38
222084822141 large conductance mechanosensitive channel protein [Agr 1 1e-37
15887877142 large conductance mechanosensitive channel protein [Agr 1 2e-37
325291918142 large conductance mechanosensitive channel protein [Agr 1 3e-37
86356220145 large-conductance mechanosensitive channel transmembran 1 5e-37
110632451142 large conductance mechanosensitive channel protein [Mes 1 7e-37
218670467153 large-conductance mechanosensitive channel [Rhizobium e 1 4e-36
218462629148 large-conductance mechanosensitive channel [Rhizobium e 1 4e-36
227820769142 large-conductance mechanosensitive channel [Sinorhizobi 1 5e-36
>gi|315121862|ref|YP_004062351.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 140 Back     alignment and organism information
 Score =  210 bits (534), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 122/141 (86%), Gaps = 1/141 (0%)

Query: 1   MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFS 60
           MF+   + +EFKKFIARGNVIDLSVG+IIGG+FNRVVQS+VEDIMMPLVGC+MG GTDFS
Sbjct: 1   MFKNILMVSEFKKFIARGNVIDLSVGVIIGGSFNRVVQSLVEDIMMPLVGCIMGGGTDFS 60

Query: 61  NYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTEN 120
           +YF PLSS IKS LI+EARKQGAVFAYGSF SV+VNF ILA VVFVLIQF NKLV+Q  +
Sbjct: 61  HYFFPLSSAIKSPLIAEARKQGAVFAYGSFISVVVNFLILAVVVFVLIQFFNKLVRQEGS 120

Query: 121 VKNPPAEVQLLTEIRDLLQKN 141
            K+   EV+LLTEIRDLL+K 
Sbjct: 121 TKS-LTEVKLLTEIRDLLKKT 140


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241203007|ref|YP_002974103.1| large-conductance mechanosensitive channel [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 145 Back     alignment and organism information
>gi|222084822|ref|YP_002543351.1| large conductance mechanosensitive channel protein [Agrobacterium radiobacter K84] Length = 141 Back     alignment and organism information
>gi|15887877|ref|NP_353558.1| large conductance mechanosensitive channel protein [Agrobacterium tumefaciens str. C58] Length = 142 Back     alignment and organism information
>gi|325291918|ref|YP_004277782.1| large conductance mechanosensitive channel protein [Agrobacterium sp. H13-3] Length = 142 Back     alignment and organism information
>gi|86356220|ref|YP_468112.1| large-conductance mechanosensitive channel transmembrane protein [Rhizobium etli CFN 42] Length = 145 Back     alignment and organism information
>gi|110632451|ref|YP_672659.1| large conductance mechanosensitive channel protein [Mesorhizobium sp. BNC1] Length = 142 Back     alignment and organism information
>gi|218670467|ref|ZP_03520138.1| large-conductance mechanosensitive channel [Rhizobium etli GR56] Length = 153 Back     alignment and organism information
>gi|218462629|ref|ZP_03502720.1| large-conductance mechanosensitive channel [Rhizobium etli Kim 5] Length = 148 Back     alignment and organism information
>gi|227820769|ref|YP_002824739.1| large-conductance mechanosensitive channel [Sinorhizobium fredii NGR234] Length = 142 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target141 large conductance mechanosensitive channel protein [Can
PRK13952142 PRK13952, mscL, large-conductance mechanosensitive chan 7e-42
PRK00567134 PRK00567, mscL, large-conductance mechanosensitive chan 2e-32
PRK13955130 PRK13955, mscL, large-conductance mechanosensitive chan 2e-24
PRK13953125 PRK13953, mscL, large-conductance mechanosensitive chan 3e-24
pfam01741127 pfam01741, MscL, Large-conductance mechanosensitive cha 6e-24
TIGR00220127 TIGR00220, mscL, large conductance mechanosensitive cha 2e-20
PRK13954119 PRK13954, mscL, large-conductance mechanosensitive chan 1e-17
COG1970130 COG1970, MscL, Large-conductance mechanosensitive chann 7e-29
>gnl|CDD|184414 PRK13952, mscL, large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>gnl|CDD|179069 PRK00567, mscL, large-conductance mechanosensitive channel; Reviewed Back     alignment and domain information
>gnl|CDD|184416 PRK13955, mscL, large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>gnl|CDD|184415 PRK13953, mscL, large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>gnl|CDD|145084 pfam01741, MscL, Large-conductance mechanosensitive channel, MscL Back     alignment and domain information
>gnl|CDD|161771 TIGR00220, mscL, large conductance mechanosensitive channel protein Back     alignment and domain information
>gnl|CDD|172460 PRK13954, mscL, large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>gnl|CDD|32153 COG1970, MscL, Large-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 141 large conductance mechanosensitive channel protein [Can
PRK13952143 mscL large-conductance mechanosensitive channel; Provis 100.0
COG1970130 MscL Large-conductance mechanosensitive channel [Cell e 100.0
PRK00567134 mscL large-conductance mechanosensitive channel; Review 100.0
pfam01741127 MscL Large-conductance mechanosensitive channel, MscL. 100.0
PRK13955130 mscL large-conductance mechanosensitive channel; Provis 100.0
PRK13953127 mscL large-conductance mechanosensitive channel; Provis 100.0
PRK13954120 mscL large-conductance mechanosensitive channel; Provis 100.0
TIGR00220139 mscL large conductance mechanosensitive channel protein 99.88
PRK13453173 F0F1 ATP synthase subunit B; Provisional 94.21
PRK07352174 F0F1 ATP synthase subunit B; Validated 93.99
PRK13461159 F0F1 ATP synthase subunit B; Provisional 91.21
PRK13415216 flagella biosynthesis protein FliZ; Provisional 90.04
>PRK13952 mscL large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>COG1970 MscL Large-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00567 mscL large-conductance mechanosensitive channel; Reviewed Back     alignment and domain information
>pfam01741 MscL Large-conductance mechanosensitive channel, MscL Back     alignment and domain information
>PRK13955 mscL large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>PRK13953 mscL large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>PRK13954 mscL large-conductance mechanosensitive channel; Provisional Back     alignment and domain information
>TIGR00220 mscL large conductance mechanosensitive channel protein; InterPro: IPR001185 Mechanosensitive ion channels (MscL) play a critical role in transducing physical stresses at the cell membrane into an electrochemical response Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK07352 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK13461 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13415 flagella biosynthesis protein FliZ; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target141 large conductance mechanosensitive channel protein [Can
2oar_A174 Mechanosensitive Channel Of Large Conductance (Mscl 3e-26
3hzq_A114 Structure Of A Tetrameric Mscl In An Expanded Inter 2e-17
>gi|126031453|pdb|2OAR|A Chain A, Mechanosensitive Channel Of Large Conductance (Mscl) Length = 174 Back     alignment and structure
 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 69/135 (51%), Gaps = 13/135 (9%)

Query: 7   VFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPL 66
           +   FK+F+ARGN++DL+V ++IG AF  +V    + I+ PL+  +             +
Sbjct: 24  MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIG------------V 71

Query: 67  SSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAG-VVFVLIQFMNKLVKQTENVKNPP 125
           +++    ++      G         S  +NFF++A  V F+++   N L K+ E  +   
Sbjct: 72  NAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGD 131

Query: 126 AEVQLLTEIRDLLQK 140
            +V LLTEIRDLL +
Sbjct: 132 TQVVLLTEIRDLLAQ 146


>gi|256599852|pdb|3HZQ|A Chain A, Structure Of A Tetrameric Mscl In An Expanded Intermediate State Length = 114 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target141 large conductance mechanosensitive channel protein [Can
2oar_A174 Large-conductance mechanosensitive channel; stretch act 9e-31
3hzq_A114 Large-conductance mechanosensitive channel; intermediat 1e-19
>2oar_A Large-conductance mechanosensitive channel; stretch activated ION channel mechanosensitive, membrane protein; 3.50A {Mycobacterium tuberculosis H37RA} SCOP: f.16.1.1 Length = 174 Back     alignment and structure
 Score =  127 bits (321), Expect = 9e-31
 Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 8   FNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLS 67
              FK+F+ARGN++DL+V ++IG AF  +V    + I+ PL+  +  N            
Sbjct: 25  LKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQS--------- 75

Query: 68  SEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTENVKNPPA 126
                 ++      G         S  +NFF++A  V F+++   N L K+ E  +    
Sbjct: 76  ---DVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDT 132

Query: 127 EVQLLTEIRDLLQK 140
           +V LLTEIRDLL +
Sbjct: 133 QVVLLTEIRDLLAQ 146


>3hzq_A Large-conductance mechanosensitive channel; intermediate state mechanosensitive channel osmoregulation, cell membrane, ION transport; 3.82A {Staphylococcus aureus subsp} Length = 114 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target141 large conductance mechanosensitive channel protein [Can
2oar_A174 Large-conductance mechanosensitive channel; stretch act 100.0
3hzq_A114 Large-conductance mechanosensitive channel; intermediat 100.0
>2oar_A Large-conductance mechanosensitive channel; stretch activated ION channel mechanosensitive, membrane protein; 3.50A {Mycobacterium tuberculosis H37RA} SCOP: f.16.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=307.69  Aligned_cols=127  Identities=33%  Similarity=0.523  Sum_probs=109.3

Q ss_pred             CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCHHHHHCCC
Q ss_conf             53012789999999836669999999999989999999999766667787504656744325762766663112321016
Q gi|254780697|r    2 FQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQ   81 (141)
Q Consensus         2 ~k~~~mlkeFK~Fi~rGNVidLAVavIIG~AF~~iV~slv~diimPlIg~i~g~g~~f~~~~~~l~~~~~~~~~~~~~~~   81 (141)
                      .|.++||||||+|++||||+|||||||||+||++||+|||+|||||+||++.++ .+++.+.+.+           ...+
T Consensus        19 ~~~k~mlkeFKeFi~rGNViDLAVgVIIGaAF~~IV~SlV~dIImPlIg~i~~~-~~~~~~~l~~-----------~~~~   86 (174)
T 2oar_A           19 DDDKHMLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVN-AQSDVGILRI-----------GIGG   86 (174)
T ss_dssp             -----CHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEECCCCTT-----------TCCS
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCCHHHHHEE-----------ECCC
T ss_conf             899999999999997287677779999999899999999987542134203457-6320233112-----------1158


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             60000989999999999999999-999999999841234889868356999999999640
Q gi|254780697|r   82 GAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTENVKNPPAEVQLLTEIRDLLQK  140 (141)
Q Consensus        82 ~~~i~yG~fl~aiI~FlIiA~vi-Flivk~~nk~~~~~e~~~~~~~e~~LL~EIRDlLkk  140 (141)
                      +..+.||+|++++|||+|+||++ |+++++|||+++++|+++++|+|++||+||||+|||
T Consensus        87 ~~~i~yG~Fl~aiInFlIiA~vvyFlivk~~nklk~k~e~~~~~~~e~~LL~EIRDlLk~  146 (174)
T 2oar_A           87 GQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQ  146 (174)
T ss_dssp             CEEECHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHH
T ss_pred             CEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             704539899999999999999999999999998622678998789478999999999997



>3hzq_A Large-conductance mechanosensitive channel; intermediate state mechanosensitive channel osmoregulation, cell membrane, ION transport; 3.82A {Staphylococcus aureus subsp} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 141 large conductance mechanosensitive channel protein [Can
d2oara1109 f.16.1.1 (A:10-118) Gated mechanosensitive channel {Myc 2e-23
>d2oara1 f.16.1.1 (A:10-118) Gated mechanosensitive channel {Mycobacterium tuberculosis [TaxId: 1773]} Length = 109 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Gated mechanosensitive channel
superfamily: Gated mechanosensitive channel
family: Gated mechanosensitive channel
domain: Gated mechanosensitive channel
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  101 bits (254), Expect = 2e-23
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 13/121 (10%)

Query: 16  ARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLI 75
           ARGN++DL+V ++IG AF  +V    + I+ PL+  +  N                  ++
Sbjct: 1   ARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQS------------DVGIL 48

Query: 76  SEARKQGAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTENVKNPPAEVQLLTEI 134
                 G         S  +NFF++A  V F+++   N L K+ E  +    +V LLTEI
Sbjct: 49  RIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEI 108

Query: 135 R 135
           R
Sbjct: 109 R 109


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target141 large conductance mechanosensitive channel protein [Can
d2oara1109 Gated mechanosensitive channel {Mycobacterium tuberculo 100.0
>d2oara1 f.16.1.1 (A:10-118) Gated mechanosensitive channel {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Gated mechanosensitive channel
superfamily: Gated mechanosensitive channel
family: Gated mechanosensitive channel
domain: Gated mechanosensitive channel
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00  E-value=7.6e-36  Score=236.09  Aligned_cols=108  Identities=33%  Similarity=0.488  Sum_probs=90.8

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             83666999999999998999999999976666778750465674432576276666311232101660000989999999
Q gi|254780697|r   16 ARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLV   95 (141)
Q Consensus        16 ~rGNVidLAVavIIG~AF~~iV~slv~diimPlIg~i~g~g~~f~~~~~~l~~~~~~~~~~~~~~~~~~i~yG~fl~aiI   95 (141)
                      .||||+|||||||||+||+++|+|||+|+|||+||++.+++   .+.++.+.         ....++..+.||+|++++|
T Consensus         1 arGNVidLAVgvIiG~AF~~iV~slV~diimPlIg~i~~~~---~~~~~~~~---------~~~~~~~~i~~G~fi~a~I   68 (109)
T d2oara1           1 ARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNA---QSDVGILR---------IGIGGGQTIDLNVLLSAAI   68 (109)
T ss_dssp             HSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---EEECCCCT---------TTCCSCEEECHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCC---CCHHHHHE---------EECCCCCEEEHHHHHHHHH
T ss_conf             98208899999999999999999999984610676615775---23124420---------2037872343889999999


Q ss_pred             HHHHHHHHH-HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             999999999-9999999998412348898683569999999
Q gi|254780697|r   96 NFFILAGVV-FVLIQFMNKLVKQTENVKNPPAEVQLLTEIR  135 (141)
Q Consensus        96 ~FlIiA~vi-Flivk~~nk~~~~~e~~~~~~~e~~LL~EIR  135 (141)
                      ||+|+||++ |+++|+|||+++++|+++++|+|++||+|||
T Consensus        69 nFlIiA~vv~F~vvk~~n~~~~k~~~~~~~p~e~~LL~EIR  109 (109)
T d2oara1          69 NFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIR  109 (109)
T ss_dssp             HHHHHHHHHHHHTHHHHHHHHHTTCCCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHC
T ss_conf             99999999999999999987405789997794779998639



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 141 large conductance mechanosensitive channel protein
2oar_A_1-126126 (A:1-126) Large-conductance mechanosensitive chann 1e-22
3hzq_A_33-11482 (A:33-114) Large-conductance mechanosensitive chan 2e-16
>2oar_A (A:1-126) Large-conductance mechanosensitive channel; stretch activated ION channel mechanosensitive, membrane protein; 3.50A {Mycobacterium tuberculosis H37RA}Length = 126 Back     alignment and structure
 Score = 99.8 bits (249), Expect = 1e-22
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 13/114 (11%)

Query: 7   VFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPL 66
           +   FK+F+ARGN++DL+V ++IG AF  +V    + I+ PL+  +  N           
Sbjct: 24  MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQS-------- 75

Query: 67  SSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTE 119
                  ++      G         S  +NFF++A  V F+++   N L K+ E
Sbjct: 76  ----DVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGE 125


>3hzq_A (A:33-114) Large-conductance mechanosensitive channel; intermediate state mechanosensitive channel osmoregulation, cell membrane, ION transport; 3.82A {Staphylococcus aureus subsp}Length = 82 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target141 large conductance mechanosensitive channel protein [Can
2oar_A_1-126126 Large-conductance mechanosensitive channel; stretc 100.0
3hzq_A_33-11482 Large-conductance mechanosensitive channel; interm 99.94
>2oar_A (A:1-126) Large-conductance mechanosensitive channel; stretch activated ION channel mechanosensitive, membrane protein; 3.50A {Mycobacterium tuberculosis H37RA} Back     alignment and structure
Probab=100.00  E-value=2.3e-36  Score=241.67  Aligned_cols=106  Identities=30%  Similarity=0.516  Sum_probs=93.4

Q ss_pred             CCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCHHHHHCCC
Q ss_conf             53012789999999836669999999999989999999999766667787504656744325762766663112321016
Q gi|254780697|r    2 FQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISEARKQ   81 (141)
Q Consensus         2 ~k~~~mlkeFK~Fi~rGNVidLAVavIIG~AF~~iV~slv~diimPlIg~i~g~g~~f~~~~~~l~~~~~~~~~~~~~~~   81 (141)
                      .+.++|++|||||++||||+|||||||||+||+++|+|||+|||||+||+++|+ .+++.+.+.+           ...+
T Consensus        19 ~~~~~~lkeFk~Fi~rGNVidLAVgvIIG~AF~~iV~slV~diImPlI~~~~~~-~~~~~~~~~~-----------~~~~   86 (126)
T 2oar_A           19 DDDKHMLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVN-AQSDVGILRI-----------GIGG   86 (126)
T ss_dssp             -----CHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEECCCCTT-----------TCCS
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCC-CCCHHHHHHE-----------ECCC
T ss_conf             899999999999996387578889999999999999999987433324423567-5212344310-----------0258


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCC
Q ss_conf             60000989999999999999999-999999999841234
Q gi|254780697|r   82 GAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTE  119 (141)
Q Consensus        82 ~~~i~yG~fl~aiI~FlIiA~vi-Flivk~~nk~~~~~e  119 (141)
                      ++++.||+|++++|||+|+|+++ |+++|++||+++|+|
T Consensus        87 ~~~i~yG~fl~aiI~FlIia~viyF~ivk~~nk~~kk~e  125 (126)
T 2oar_A           87 GQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGE  125 (126)
T ss_dssp             CEEECHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTTC
T ss_pred             CCEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             705750188999999999999999999999998732578



>3hzq_A (A:33-114) Large-conductance mechanosensitive channel; intermediate state mechanosensitive channel osmoregulation, cell membrane, ION transport; 3.82A {Staphylococcus aureus subsp} Back     alignment and structure