254780698

254780698

D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein

GeneID in NCBI database:8209702Locus tag:CLIBASIA_02925
Protein GI in NCBI database:254780698Protein Accession:YP_003065111.1
Gene range:-(569522, 570532)Protein Length:336aa
Gene description:D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein
COG prediction:[M] D-alanyl-D-alanine carboxypeptidase
KEGG prediction:D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein; K01286 D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
SEED prediction:D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Murein Hydrolases;
Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MLQQKIQSSAKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKKTLKHQQTHRKDNLSSTSLKKSLMIKKLKRTYSQFKKIDAKAHSTQ
cHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEccccccccHHHHHHHHHHHHHHHHHccccccccEEEccHHHHcccccEEEEccccEEEHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEccccccccccEEcHHHHHHHHHHHHHHcHHHHHHHccEEEEEccEEEEEEcccccccccccEEEEEEEcccccEEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHcccccHHHHHcccccccc
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccEEEccccccccccHHHHHHHHHHHHHHHHcccccccccEEEcccHHcccccEEEEccccEEEHHHHHccEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccHcEHEEcEEEEEcccEccccccccEccccccccccccccccccEEEEEccccccEEEEEEEccccHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEccccEEEEcccccEEEEEccccHcccccc
MLQQKIQSSakktfltypygsiyiQRNIQLMGKILFLSIIMISMASelhakpkyssividvnknqmtgfkqdeprypaslTKMMTLYIIFEYLQSkklhlntqipvsktaatqnpsklylkektyfTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKnasglhdknqitTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHnidgiktgytrnsgfnivtslrykddpivavvmgmptsqeRDQKALELITSFLEKKTLKHqqthrkdnlsstsLKKSLMIKKLKRTYSQFKKIdakahstq
mlqqkiqssakktfltypYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQmtgfkqdepryPASLTKMMTLYIIFEYLQSKKLHLNTQIpvsktaatqnpskLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGillrknfpQYYKYFSIRKFRYRNRIITNHNKLLNKMhnidgiktgytrnSGFNIvtslrykddpIVAVVMGMPTSQERDQKALELITSFLEKKtlkhqqthrkdnlsstslkkslmIKKLKrtysqfkkidakahstq
MLQQKIQSSAKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKKTLKHQQTHRKDNlsstslkkslmikklkRTYSQFKKIDAKAHSTQ
**************LTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQE*DQKALELITSFLEKKTLKHQ***********SLK**************************
*********AKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKK**************STSLKKSLMIKKLKRTYSQFKKIDAKAHSTQ
*****IQSSAKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKKTLKHQQTHRKDNLSSTSLKKSLMIKKLKRTYSQFKKID*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQQKIQSSAKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKKTLKHQQTHRKDNLSSTSLKKSLMIKKLKRTYSQFKKIDAKAHSTQ
MLQQKIQSSAKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKKTLKHQQTHRKDNLSSTSLKKSLMIKKLKRTYSQFKKIDAKAHSTQ
MLQQKIQSSAKKTFLTYPYGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIVIDVNKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKKTLKHQQTHRKDNLSSTSLKKSLMIKKLKRTYSQFKKIDAKAHSTQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin
254780435336 peptidase S11, D-alanyl-D-alanine carboxypeptidase 3e-40
>gi|254780435|ref|YP_003064848.1| peptidase S11, D-alanyl-D-alanine carboxypeptidase 1 [Candidatus Liberibacter asiaticus str. psy62] Length = 336 Back     alignment
 Score =  157 bits (397), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 141/267 (52%), Gaps = 12/267 (4%)

Query: 36  FLSIIMISMAS---------ELHAKPKYSSIVIDVNKNQMTGFK-QDEPRYPASLTKMMT 85
           FL II ++M S         E +  P Y+  ++D N   +      D P  PASLTK+MT
Sbjct: 4   FLVIIAMAMLSNIFPFLSIAETNKLPYYT--LLDTNTGHVIAENYPDHPWNPASLTKLMT 61

Query: 86  LYIIFEYLQSKKLHLNTQIPVSKTAATQNPSKLYLKEKTYFTTEQGILALITRSANDVST 145
            Y++F +L+ KK  L T I +SK A+   PS    K+ +  T +  +  LI +SAND++ 
Sbjct: 62  AYVVFSFLKEKKAMLTTPITISKNASEYPPSNSTFKKGSTMTLDNALKLLIVKSANDIAV 121

Query: 146 AFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNF 205
           A  E +  +EKKF   M+N +K +G+  T + NA G+      TTARD AIL   ++ +F
Sbjct: 122 AIAESLCKTEKKFVQHMNNTSKNLGLSATHFMNAHGVVQHGHYTTARDMAILSWRIKTDF 181

Query: 206 PQYYKYFSIRKFRYRNRIITNHNKLLNKMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVA 265
           PQY  YF I+    + +   N N  +      DG+KTG+T  SGFNIV S    D  ++A
Sbjct: 182 PQYMHYFQIKGLEIKGKKYPNTNWAVGTFLGADGMKTGFTCASGFNIVASAIQGDQSLIA 241

Query: 266 VVMGMPTSQERDQKALELITSFLEKKT 292
           V++G      R++ +  L++     KT
Sbjct: 242 VILGALDRNTRNKVSASLLSMGFYNKT 268

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin
315121863357 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin 1 1e-123
222148621 484 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin 1 4e-70
150396261 494 Serine-type D-Ala-D-Ala carboxypeptidase [Sinorhizobium 1 5e-69
307321507 500 Serine-type D-Ala-D-Ala carboxypeptidase [Sinorhizobium 1 1e-68
195970177 500 hypothetical protein SMc00996 [Sinorhizobium meliloti 1 1 1e-68
325292859 480 D-alanyl-D-alanine carboxypeptidase [Agrobacterium sp. 1 5e-68
227821811 498 penicillin-binding protein [Sinorhizobium fredii NGR234 1 1e-67
218663522 430 probable serine-type D-Ala-D-Ala carboxypeptidase prote 1 2e-66
116252287 523 penicillin-binding protein/D-alanyl-D-alanine carboxype 1 2e-65
159184788 499 penicillin-binding protein [Agrobacterium tumefaciens s 1 2e-65
>gi|315121863|ref|YP_004062352.1| D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 357 Back     alignment and organism information
 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 266/330 (80%), Gaps = 3/330 (0%)

Query: 1   MLQQKIQSSAKKTFLTYP--YGSIYIQRNIQLMGKILFLSIIMISMASELHAKPKYSSIV 58
           MLQQ  +   KK FL Y   Y S  IQ +++ + KIL L II+ SMA + HAK +YSSIV
Sbjct: 1   MLQQNTKYLEKKQFLEYVSVYRSFIIQESLRSLWKILLLCIILTSMALKSHAKLEYSSIV 60

Query: 59  IDV-NKNQMTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQNPSK 117
           ID+ N  +  GFKQD+ RYPASLTKMMTLYIIFE+LQSKK+HLNT+IPVSKTA  Q PSK
Sbjct: 61  IDLLNDKRTNGFKQDKLRYPASLTKMMTLYIIFEHLQSKKMHLNTKIPVSKTATIQPPSK 120

Query: 118 LYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYK 177
           LYLKE T+FT EQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAK +GM +T YK
Sbjct: 121 LYLKENTFFTVEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKSLGMNHTTYK 180

Query: 178 NASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLNKMHNI 237
           NASGLHDKNQ TTARDQAILGI +RKNFPQYYKYFSIRKF+YRN+II NHNKL+NK+H I
Sbjct: 181 NASGLHDKNQKTTARDQAILGITIRKNFPQYYKYFSIRKFQYRNKIILNHNKLINKIHGI 240

Query: 238 DGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQERDQKALELITSFLEKKTLKHQQ 297
           DGIKTGYTR+SGFNIV SL+ +++ I+AVVMGMPT Q+RDQKALELI SFL  K  KH+ 
Sbjct: 241 DGIKTGYTRDSGFNIVASLQNENNSIIAVVMGMPTCQKRDQKALELINSFLNTKKTKHKP 300

Query: 298 THRKDNLSSTSLKKSLMIKKLKRTYSQFKK 327
             +  NL+ +   K+L+ +K+K +  Q  K
Sbjct: 301 IWKSGNLTFSPTMKALITEKIKDSNQQLPK 330


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148621|ref|YP_002549578.1| D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein [Agrobacterium vitis S4] Length = 484 Back     alignment and organism information
>gi|150396261|ref|YP_001326728.1| Serine-type D-Ala-D-Ala carboxypeptidase [Sinorhizobium medicae WSM419] Length = 494 Back     alignment and organism information
>gi|307321507|ref|ZP_07600902.1| Serine-type D-Ala-D-Ala carboxypeptidase [Sinorhizobium meliloti AK83] Length = 500 Back     alignment and organism information
>gi|195970177|ref|NP_385517.2| hypothetical protein SMc00996 [Sinorhizobium meliloti 1021] Length = 500 Back     alignment and organism information
>gi|325292859|ref|YP_004278723.1| D-alanyl-D-alanine carboxypeptidase [Agrobacterium sp. H13-3] Length = 480 Back     alignment and organism information
>gi|227821811|ref|YP_002825781.1| penicillin-binding protein [Sinorhizobium fredii NGR234] Length = 498 Back     alignment and organism information
>gi|218663522|ref|ZP_03519452.1| probable serine-type D-Ala-D-Ala carboxypeptidase protein [Rhizobium etli IE4771] Length = 430 Back     alignment and organism information
>gi|116252287|ref|YP_768125.1| penicillin-binding protein/D-alanyl-D-alanine carboxypeptidase [Rhizobium leguminosarum bv. viciae 3841] Length = 523 Back     alignment and organism information
>gi|159184788|ref|NP_354511.2| penicillin-binding protein [Agrobacterium tumefaciens str. C58] Length = 499 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin
pfam00768241 pfam00768, Peptidase_S11, D-alanyl-D-alanine carboxypep 6e-39
PRK10793403 PRK10793, PRK10793, D-alanyl-D-alanine carboxypeptidase 2e-35
PRK10001400 PRK10001, PRK10001, D-alanyl-D-alanine carboxypeptidase 1e-32
PRK11397388 PRK11397, dacD, D-alanyl-D-alanine carboxypeptidase; Pr 4e-30
PRK11669306 PRK11669, pbpG, D-alanyl-D-alanine endopeptidase; Provi 7e-07
COG1686389 COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cel 3e-58
>gnl|CDD|144388 pfam00768, Peptidase_S11, D-alanyl-D-alanine carboxypeptidase Back     alignment and domain information
>gnl|CDD|182736 PRK10793, PRK10793, D-alanyl-D-alanine carboxypeptidase fraction A; Provisional Back     alignment and domain information
>gnl|CDD|182189 PRK10001, PRK10001, D-alanyl-D-alanine carboxypeptidase fraction C; Provisional Back     alignment and domain information
>gnl|CDD|183117 PRK11397, dacD, D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>gnl|CDD|183269 PRK11669, pbpG, D-alanyl-D-alanine endopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|31872 COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin
PRK11397390 dacD D-alanyl-D-alanine carboxypeptidase; Provisional 100.0
PRK10793403 D-alanyl-D-alanine carboxypeptidase fraction A; Provisi 100.0
PRK10001400 D-alanyl-D-alanine carboxypeptidase fraction C; Provisi 100.0
COG1686389 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope 100.0
PRK11669308 pbpG D-alanyl-D-alanine endopeptidase; Provisional 100.0
PRK10795619 penicillin-binding protein 2; Provisional 98.59
COG0768599 FtsI Cell division protein FtsI/penicillin-binding prot 96.41
COG2602254 Beta-lactamase class D [Defense mechanisms] 94.87
PRK11240 770 penicillin-binding protein 1C; Provisional 93.83
pfam00768241 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase. 100.0
COG2367329 PenP Beta-lactamase class A [Defense mechanisms] 99.38
pfam00905296 Transpeptidase Penicillin binding protein transpeptidas 98.65
PRK11113477 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Prov 99.16
COG2027470 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-bi 97.44
PRK11289387 ampC beta-lactamase; Provisional 98.46
pfam00144327 Beta-lactamase Beta-lactamase. This family appears to b 98.19
PRK09506839 mrcB penicillin-binding protein 1b; Reviewed 97.0
PRK11636 850 mrcA peptidoglycan synthetase; Provisional 96.83
TIGR02074700 PBP_1a_fam penicillin-binding protein, 1A family; Inter 96.3
COG0744661 MrcB Membrane carboxypeptidase (penicillin-binding prot 91.05
TIGR03423592 pbp2_mrdA penicillin-binding protein 2. Members of this 98.23
COG2027 470 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-bi 96.31
PRK10662377 beta-lactamase/D-alanine carboxypeptidase; Provisional 98.12
pfam02113383 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) fami 97.93
TIGR00666427 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-ala 96.23
PRK13128 518 D-aminopeptidase; Reviewed 96.95
PRK03642432 hypothetical protein; Provisional 96.93
COG1680390 AmpC Beta-lactamase class C and other penicillin bindin 95.46
TIGR00666 427 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-ala 94.65
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>PRK10793 D-alanyl-D-alanine carboxypeptidase fraction A; Provisional Back     alignment and domain information
>PRK10001 D-alanyl-D-alanine carboxypeptidase fraction C; Provisional Back     alignment and domain information
>COG1686 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11669 pbpG D-alanyl-D-alanine endopeptidase; Provisional Back     alignment and domain information
>PRK10795 penicillin-binding protein 2; Provisional Back     alignment and domain information
>COG0768 FtsI Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2602 Beta-lactamase class D [Defense mechanisms] Back     alignment and domain information
>PRK11240 penicillin-binding protein 1C; Provisional Back     alignment and domain information
>pfam00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase Back     alignment and domain information
>COG2367 PenP Beta-lactamase class A [Defense mechanisms] Back     alignment and domain information
>pfam00905 Transpeptidase Penicillin binding protein transpeptidase domain Back     alignment and domain information
>PRK11113 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Provisional Back     alignment and domain information
>COG2027 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11289 ampC beta-lactamase; Provisional Back     alignment and domain information
>pfam00144 Beta-lactamase Beta-lactamase Back     alignment and domain information
>PRK09506 mrcB penicillin-binding protein 1b; Reviewed Back     alignment and domain information
>PRK11636 mrcA peptidoglycan synthetase; Provisional Back     alignment and domain information
>TIGR02074 PBP_1a_fam penicillin-binding protein, 1A family; InterPro: IPR011816 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task Back     alignment and domain information
>COG0744 MrcB Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03423 pbp2_mrdA penicillin-binding protein 2 Back     alignment and domain information
>COG2027 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10662 beta-lactamase/D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>pfam02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family Back     alignment and domain information
>TIGR00666 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase; InterPro: IPR000667 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>PRK13128 D-aminopeptidase; Reviewed Back     alignment and domain information
>PRK03642 hypothetical protein; Provisional Back     alignment and domain information
>COG1680 AmpC Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms] Back     alignment and domain information
>TIGR00666 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase; InterPro: IPR000667 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin
3it9_A352 Crystal Structure Of Penicillin-Binding Protein 6 ( 3e-49
1nzo_A363 The Crystal Structure Of Wild Type Penicillin-Bindi 2e-47
1hd8_A363 Crystal Structure Of A Deacylation-Defective Mutant 5e-47
3a3j_A344 Crystal Structures Of Penicillin Binding Protein 5 2e-45
1xp4_A379 Crystal Structure Of A Peptidoglycan Synthesis Regu 2e-31
3mfd_A334 The Structure Of The Beta-Lactamase Superfamily Dom 1e-29
2bcf_A276 Crystal Structure Of A Evolved Putative Penicillin- 6e-26
1skf_A262 Crystal Structure Of The Streptomyces K15 Dd-Transp 6e-25
1es2_A262 S96a Mutant Of Streptomyces K15 Dd-Transpeptidase L 6e-25
1es4_A262 C98n Mutant Of Streptomyces K15 Dd-Transpeptidase L 1e-24
1es5_A262 S216a Mutant Of Streptomyces K15 Dd-Transpeptidase 1e-24
1es3_A262 C98a Mutant Of Streptomyces K15 Dd-Transpeptidase L 1e-24
1esi_A262 R248l Mutant Of Streptomyces K15 Dd-Transpeptidase 6e-24
1j9m_A262 K38h Mutant Of Streptomyces K15 Dd-Transpeptidase L 3e-23
1tvf_A369 Crystal Structure Of Penicillin-Binding Protein 4 ( 2e-20
3hum_A453 Crystal Structure Of Penicillin Binding Protein 4 F 2e-20
>gi|261825019|pdb|3IT9|A Chain A, Crystal Structure Of Penicillin-Binding Protein 6 (Pbp6) From E. Coli In Apo State Length = 352 Back     alignment and structure
 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 73/270 (27%), Positives = 130/270 (48%), Gaps = 8/270 (2%)

Query: 45  ASELHAKPKYSSIVIDVNKNQMTGFKQDEPRY-PASLTKMMTLYIIFEYLQSKKLHLNTQ 103
             E  +    + I++D    ++      + +  PASLTK+MT Y++ + L++ K+ L   
Sbjct: 5   TVEAPSVDARAWILMDYASGKVLAEGNADEKLDPASLTKIMTSYVVGQALKADKIKLTDM 64

Query: 104 IPVSKTAATQNPS------KLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKK 157
           + V K A             ++LK     +       +I +S ND   A  ++++GS++ 
Sbjct: 65  VTVGKDAWATGNPALRGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQES 124

Query: 158 FAILMSNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKF 217
           F  LM+  AKK+G+ NT ++   GL    Q +TARD A+LG  L  + P+ Y     ++F
Sbjct: 125 FIGLMNGYAKKLGLTNTTFQTVHGLDAPGQFSTARDMALLGKALIHDVPEEYAIHKEKEF 184

Query: 218 RYRNRIITNHNKLLNKMH-NIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMGMPTSQER 276
            +      N N+LL   + N+DG+KTG T  +G+N+V S    D  +++VV+G  T + R
Sbjct: 185 TFNKIRQPNRNRLLWSSNLNVDGMKTGTTAGAGYNLVASATQGDMRLISVVLGAKTDRIR 244

Query: 277 DQKALELITSFLEKKTLKHQQTHRKDNLSS 306
             ++ +L+T                  ++ 
Sbjct: 245 FNESEKLLTWGFRFFETVTPIKPDATFVTQ 274


>gi|42543137|pdb|1NZO|A Chain A, The Crystal Structure Of Wild Type Penicillin-Binding Protein 5 From E. Coli Length = 363 Back     alignment and structure
>gi|17942531|pdb|1HD8|A Chain A, Crystal Structure Of A Deacylation-Defective Mutant Of Penicillin-Binding Protein 5 At 2.3 A Resolution Length = 363 Back     alignment and structure
>gi|281500691|pdb|3A3J|A Chain A, Crystal Structures Of Penicillin Binding Protein 5 From Haemophilus Influenzae Length = 344 Back     alignment and structure
>gi|56967192|pdb|1XP4|A Chain A, Crystal Structure Of A Peptidoglycan Synthesis Regulatory Factor (Pbp3) From Streptococcus Pneumoniae Length = 379 Back     alignment and structure
>gi|296278518|pdb|3MFD|A Chain A, The Structure Of The Beta-Lactamase Superfamily Domain Of D- Alanine Carboxypeptidase From Bacillus Subtilis Length = 334 Back     alignment and structure
>gi|82408083|pdb|2BCF|A Chain A, Crystal Structure Of A Evolved Putative Penicillin-Binding Protein Homolog, Rv2911, From Mycobacterium Tuberculosis Length = 276 Back     alignment and structure
>gi|157833819|pdb|1SKF|A Chain A, Crystal Structure Of The Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766851|pdb|1ES2|A Chain A, S96a Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766853|pdb|1ES4|A Chain A, C98n Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766854|pdb|1ES5|A Chain A, S216a Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766852|pdb|1ES3|A Chain A, C98a Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|7766855|pdb|1ESI|A Chain A, R248l Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|14719796|pdb|1J9M|A Chain A, K38h Mutant Of Streptomyces K15 Dd-Transpeptidase Length = 262 Back     alignment and structure
>gi|50513810|pdb|1TVF|A Chain A, Crystal Structure Of Penicillin-Binding Protein 4 (Pbp4) From Staphylococcus Aureus Length = 369 Back     alignment and structure
>gi|266618633|pdb|3HUM|A Chain A, Crystal Structure Of Penicillin Binding Protein 4 From Staphylococcus Aureus Col In Complex With Cefotaxime Length = 453 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin
3a3j_A344 PBP5; penicillin binding protein 5, DACA, hydrolase; 2. 1e-42
3mfd_A334 D-alanyl-D-alanine carboxypeptidase DACB; penicillin-bi 2e-42
1es5_A262 DD-transpeptidase; penicillin-binding, serine peptidase 1e-40
3ita_A352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-b 7e-40
1z6f_A363 Penicillin-binding protein 5; peptidoglycan synthesis, 3e-37
1n9b_A265 Penicillinase, beta-lactamase SHV-2; beta-lactam hydrol 1e-36
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ultra- 2e-36
1hzo_A271 Beta-lactamase; mixed alpha/beta, cephalosporinase, hyd 1e-34
1o7e_A276 L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrop 5e-34
3m6b_A265 Beta-lactamase, penicillinase; alpha-beta structure, an 6e-34
3hun_A453 Penicillin-binding protein 4; ampicillin, beta-lactamas 3e-32
2p74_A263 Beta-lactamase CTX-M-9A; ultra-high resolution, acylati 3e-32
3cg5_A265 Beta-lactamase, penicillinase; alpha-beta structure, co 7e-32
1g6a_A271 Beta-lactamase PSE-4; class A beta-lactamase, carbenici 1e-31
3lez_A260 Beta-lactamase; antibiotic resistance, halotolerant, DE 6e-31
3dw0_A294 Class A carbapenemase KPC-2; beta-lactamase, antibiotic 6e-30
1tvf_A369 PBP4, penicillin binding protein 4; structural genomics 7e-30
2wk0_A265 Beta-lactamase; hydrolase, iodopenicillanate, antibioti 4e-29
1bue_A265 Protein (imipenem-hydrolysing beta-lactamase); hydrolas 4e-29
2cc1_A262 Beta-lactamase, penicillinase; hydrolase, antibiotic re 8e-29
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiotic re 1e-28
1bsg_A266 Beta lactamase, penicillinase; hydrolase, antibiotic re 1e-28
3c5a_A264 Class A carbapenemase KPC-2; beta-lactamase, C-terminal 5e-28
1xp4_A379 D-alanyl-D-alanine carboxypeptidase; five-stranded anti 1e-26
2bcf_A276 Probable D-alanyl-D-alanine carboxypeptidase DACB2; pen 3e-25
2j9o_A298 TLL2115 protein; penicillin-binding protein, hydrolase, 1e-24
3p09_A290 Beta-lactamase; structural genomics, center for structu 2e-24
3cjm_A282 Putative beta-lactamase; NP_815223.1, structural genomi 2e-24
1e25_A282 Extended-spectrum beta-lactamase PER-1; hydrolase, anti 3e-24
2qpn_A287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1 3e-24
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus licheni 5e-24
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 2e-07
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted, ant 9e-19
>3a3j_A PBP5; penicillin binding protein 5, DACA, hydrolase; 2.15A {Haemophilus influenzae} Length = 344 Back     alignment and structure
 Score =  168 bits (427), Expect = 1e-42
 Identities = 78/244 (31%), Positives = 137/244 (56%), Gaps = 9/244 (3%)

Query: 47  ELHAKPKYSSIVIDVNKNQ-MTGFKQDEPRYPASLTKMMTLYIIFEYLQSKKLHLNTQIP 105
           ++ A+   + +++D N    +T    D+ +YPASLTKMMT Y++   L+  K+H    + 
Sbjct: 6   QITAQ---TYVLMDYNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVT 62

Query: 106 VSKTAATQN---PSKLYLKEKTYFTTEQGILALITRSANDVSTAFGEFISGSEKKFAILM 162
           + ++A  +N    SK++L   T  +       +I  S ND + A  E ISG+   F   M
Sbjct: 63  IGESAWGRNFPDSSKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETM 122

Query: 163 SNKAKKIGMQNTIYKNASGLHDKNQITTARDQAILGILLRKNFPQYYKYFSIRKFRYRNR 222
           +   ++ G++NT +    GL D NQ ++ARD AI+G  + ++ P+ YK +S + F +   
Sbjct: 123 NKYVQQFGLKNTNFTTPHGLDDPNQYSSARDMAIIGAHIIRDLPEEYKIYSEKDFTFNKI 182

Query: 223 IITNHNK-LLNKMHNIDGIKTGYTRNSGFNIVTSLRYKD-DPIVAVVMGMPTSQERDQKA 280
              N N  L +K  N+DG+KTG+T  +G+N+V S    +   +++VVMG+PT + R+ ++
Sbjct: 183 KQPNRNGLLWDKTINVDGMKTGHTSQAGYNLVASATTSNNMRLISVVMGVPTYKGREVES 242

Query: 281 LELI 284
            +L+
Sbjct: 243 KKLL 246


>3mfd_A D-alanyl-D-alanine carboxypeptidase DACB; penicillin-binding protein 5*, beta-lactamase, structural GE PSI-2, protein structure initiative; HET: CIT; 1.75A {Bacillus subtilis} Length = 334 Back     alignment and structure
>1es5_A DD-transpeptidase; penicillin-binding, serine peptidase, beta-lactamase, hydrolase carboxypeptidase; 1.40A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1skf_A 1es2_A 1j9m_A 1esi_A 1es3_A 1es4_A Length = 262 Back     alignment and structure
>3ita_A D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-binding protein, BP6, DD-carboxypeptidase, peptidoglycan, ampicillin, acyl-enzyme complex; HET: AIX AIC; 1.80A {Escherichia coli} PDB: 3it9_A* 3itb_A* Length = 352 Back     alignment and structure
>1z6f_A Penicillin-binding protein 5; peptidoglycan synthesis, DD- carboxypeptidase, hydrolase, boronic acid; HET: BO9; 1.60A {Escherichia coli} SCOP: b.105.1.1 e.3.1.1 PDB: 1nzu_A 1nzo_A* 3beb_A* 3bec_A* 1nj4_A 1hd8_A 1sdn_A Length = 363 Back     alignment and structure
>1n9b_A Penicillinase, beta-lactamase SHV-2; beta-lactam hydrolase, detergent binding, drug design, radiation damage; HET: MA4 EPE; 0.90A {Klebsiella pneumoniae} SCOP: e.3.1.1 PDB: 3d4f_A* 2zd8_A* 1q2p_A* 1shv_A* 1vm1_A* 2g2u_A 2h5s_A* 1ong_A* 3c4o_A 3c4p_A 2a3u_A* 1tdg_A* 1tdl_A* 2a49_A* 2g2w_A 1rcj_A* 2h0t_A* 2h0y_A* 2h10_A* Length = 265 Back     alignment and structure
>1m40_A TEM-1, beta-lactamase TEM; acylation mechanism, ultra- high resolution, hydrolase; HET: CB4; 0.85A {Escherichia coli} SCOP: e.3.1.1 PDB: 1jwp_A* 1nxy_A* 1ny0_A* 1nym_A* 1nyy_A* 1pzo_A* 1erm_A* 1ero_A* 1erq_A* 1s0w_A 1xpb_A 1li0_A 1htz_A 1jtd_A 1esu_A 1jwz_A* 1li9_A 1jwv_A* 1jtg_A 1axb_A* ... Length = 263 Back     alignment and structure
>1hzo_A Beta-lactamase; mixed alpha/beta, cephalosporinase, hydrolase; HET: MES; 1.75A {Proteus vulgaris} SCOP: e.3.1.1 Length = 271 Back     alignment and structure
>1o7e_A L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrophomonas maltophilia} SCOP: e.3.1.1 PDB: 1n4o_A Length = 276 Back     alignment and structure
>3m6b_A Beta-lactamase, penicillinase; alpha-beta structure, antibiotic resistance, cell membrane, hydrolase, lipoprotein, membrane; HET: 1RG; 1.30A {Mycobacterium tuberculosis} PDB: 3dwz_A* 3iqa_A* 3cg5_A* 3m6h_A* 2gdn_A Length = 265 Back     alignment and structure
>3hun_A Penicillin-binding protein 4; ampicillin, beta-lactamase, serine type D-Ala, D-Ala-carboxypeptidase, hydrolase; HET: ZZ7; 2.00A {Staphylococcus aureus} PDB: 3hum_A* Length = 453 Back     alignment and structure
>2p74_A Beta-lactamase CTX-M-9A; ultra-high resolution, acylation, ESBL, hydrolase; HET: PO4; 0.88A {Escherichia coli} PDB: 3g2y_A* 1ylj_A* 1yly_A* 1ym1_A* 1yms_A* 1ymx_A* 3g2z_A* 3g30_A* 3g31_A* 3g32_A* 3g34_A* 3g35_A* 1ylt_A* 1ylz_A* 1ylw_A 1ylp_A* 1iys_A 2zq8_A* 1we4_A 1bza_A ... Length = 263 Back     alignment and structure
>3cg5_A Beta-lactamase, penicillinase; alpha-beta structure, covalent adduct, antibiotic resistance, hydrolase, lipoprotein, membrane; HET: ISS; 1.70A {Mycobacterium tuberculosis} PDB: 3dwz_A* 2gdn_A Length = 265 Back     alignment and structure
>1g6a_A Beta-lactamase PSE-4; class A beta-lactamase, carbenicillinase, R234K mutant, hydrolase; 1.75A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1g68_A Length = 271 Back     alignment and structure
>3lez_A Beta-lactamase; antibiotic resistance, halotolerant, DEEP- SEA bacterium, hydrolase; HET: EPE; 1.25A {Oceanobacillus iheyensis} Length = 260 Back     alignment and structure
>3dw0_A Class A carbapenemase KPC-2; beta-lactamase, antibiotic resistance, hydrolase; 1.60A {Escherichia coli} Length = 294 Back     alignment and structure
>1tvf_A PBP4, penicillin binding protein 4; structural genomics, nysgxrc target, SAV0642, PSI, protein structure initiative; 2.00A {Staphylococcus aureus} SCOP: b.105.1.2 e.3.1.1 Length = 369 Back     alignment and structure
>2wk0_A Beta-lactamase; hydrolase, iodopenicillanate, antibiotic resistance; HET: BIY CIT; 1.65A {Bacillus licheniformis} PDB: 3b3x_A* 1i2s_A* 1i2w_A* 2blm_A 4blm_A 1mbl_A Length = 265 Back     alignment and structure
>1bue_A Protein (imipenem-hydrolysing beta-lactamase); hydrolase, antibiotic resistance, class A carbapenemase; 1.64A {Enterobacter cloacae} SCOP: e.3.1.1 PDB: 1bul_A* 1dy6_A Length = 265 Back     alignment and structure
>2cc1_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, broad-spectrum; 2.13A {Mycobacterium fortuitum} SCOP: e.3.1.1 Length = 262 Back     alignment and structure
>1ghp_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, beta-lactam hydrolysis, benzylpenicillin, cephaloridine; HET: PNM; 1.76A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1ghi_A* 1ghm_A* 1kgf_A 1kge_A 1ome_A 1kgg_A 1dja_A 3blm_A 1blh_A* 1blc_A 1djc_A 1djb_A 1blp_A 1pio_A Length = 258 Back     alignment and structure
>1bsg_A Beta lactamase, penicillinase; hydrolase, antibiotic resistance; 1.85A {Streptomyces albus G} SCOP: e.3.1.1 Length = 266 Back     alignment and structure
>3c5a_A Class A carbapenemase KPC-2; beta-lactamase, C-terminal deleted mutant, plasmid, hydrolase; HET: CIT; 1.23A {Escherichia coli} PDB: 2ods_A 2ov5_A* 3e2k_A 3e2l_A* Length = 264 Back     alignment and structure
>1xp4_A D-alanyl-D-alanine carboxypeptidase; five-stranded antiparallel beta-sheet, omega-like loop, hydrolase; 2.80A {Streptococcus pneumoniae R6} SCOP: b.105.1.1 e.3.1.1 Length = 379 Back     alignment and structure
>2bcf_A Probable D-alanyl-D-alanine carboxypeptidase DACB2; penicillin-binding protein, DD-2 carboxypeptidase, directed evolution; 2.30A {Mycobacterium tuberculosis} Length = 276 Back     alignment and structure
>2j9o_A TLL2115 protein; penicillin-binding protein, hydrolase, lactamase, thioesterase, DD-peptidase; 1.50A {Synechococcus elongatus} PDB: 2jbf_A* 2j7v_A 2j8y_A* Length = 298 Back     alignment and structure
>3p09_A Beta-lactamase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich, cytosol; HET: MSE; 1.90A {Francisella tularensis subsp} Length = 290 Back     alignment and structure
>3cjm_A Putative beta-lactamase; NP_815223.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.50A {Enterococcus faecalis V583} Length = 282 Back     alignment and structure
>1e25_A Extended-spectrum beta-lactamase PER-1; hydrolase, antibiotic resistance, class A cephalosporinase; 1.9A {Pseudomonas aeruginosa} SCOP: e.3.1.1 Length = 282 Back     alignment and structure
>2qpn_A Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1.10A {Klebsiella pneumoniae} Length = 287 Back     alignment and structure
>1w7f_A Beta-lactamase; hydrolase, isocitrate, bacillus licheniformis hydrolase; HET: ICT; 1.80A {Bacillus licheniformis} Length = 307 Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Length = 318 Back     alignment and structure
>1alq_A CP254 beta-lactamase; hydrolase, circular permuted, antibiotic resistance; 1.80A {Staphylococcus aureus} SCOP: e.3.1.1 Length = 266 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target336 D-alanyl-D-alanine carboxypeptidase 1 penicillin-bindin
3hun_A453 Penicillin-binding protein 4; ampicillin, beta-lactamas 100.0
3ita_A352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-b 100.0
1z6f_A363 Penicillin-binding protein 5; peptidoglycan synthesis, 100.0
3a3j_A344 PBP5; penicillin binding protein 5, DACA, hydrolase; 2. 100.0
1xp4_A379 D-alanyl-D-alanine carboxypeptidase; five-stranded anti 100.0
1tvf_A369 PBP4, penicillin binding protein 4; structural genomics 100.0
3mfd_A334 D-alanyl-D-alanine carboxypeptidase DACB; penicillin-bi 100.0
1es5_A262 DD-transpeptidase; penicillin-binding, serine peptidase 100.0
2bcf_A276 Probable D-alanyl-D-alanine carboxypeptidase DACB2; pen 100.0
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus licheni 100.0
2cc1_A262 Beta-lactamase, penicillinase; hydrolase, antibiotic re 100.0
3dw0_A294 Class A carbapenemase KPC-2; beta-lactamase, antibiotic 100.0
2j9o_A298 TLL2115 protein; penicillin-binding protein, hydrolase, 100.0
1n9b_A265 Penicillinase, beta-lactamase SHV-2; beta-lactam hydrol 100.0
2wk0_A265 Beta-lactamase; hydrolase, iodopenicillanate, antibioti 99.98
1o7e_A276 L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrop 99.98
3c5a_A264 Class A carbapenemase KPC-2; beta-lactamase, C-terminal 99.97
3p09_A290 Beta-lactamase; structural genomics, center for structu 99.97
1hzo_A271 Beta-lactamase; mixed alpha/beta, cephalosporinase, hyd 99.97
1g6a_A271 Beta-lactamase PSE-4; class A beta-lactamase, carbenici 99.96
1bsg_A266 Beta lactamase, penicillinase; hydrolase, antibiotic re 99.96
1e25_A282 Extended-spectrum beta-lactamase PER-1; hydrolase, anti 99.96
3cjm_A282 Putative beta-lactamase; NP_815223.1, structural genomi 99.95
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiotic re 99.95
3hbr_A265 OXA-48; class D beta-lactamase, antibiotic, dimer, hydr 99.17
1yqs_A349 D-alanyl-D-alanine carboxypeptidase; cell well biosynth 98.47
2qpn_A287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1 100.0
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ultra- 100.0
3m6b_A265 Beta-lactamase, penicillinase; alpha-beta structure, an 100.0
2p74_A263 Beta-lactamase CTX-M-9A; ultra-high resolution, acylati 100.0
1bue_A265 Protein (imipenem-hydrolysing beta-lactamase); hydrolas 99.97
3lez_A260 Beta-lactamase; antibiotic resistance, halotolerant, DE 99.96
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted, ant 99.92
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 99.85
1nrf_A262 Regulatory protein BLAR1; penicillin-receptor, beta-lac 99.02
2iwb_A246 Methicillin resistance MECR1 protein; antibiotic resist 98.89
1k38_A254 Penicillinase, beta-lactamase OXA-2; serine beta-lactam 98.82
1k55_A246 Beta lactamase OXA-10; antibiotic resistance, carbamyla 98.73
1xkz_A255 Regulatory protein BLAR1; beta-lactam receptor, signal 98.73
3g4p_A244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme me 98.65
3isg_A251 Penicillinase, beta-lactamase OXA-1; hydrolase, lysine 98.56
3fwm_A751 Penicillin-binding protein 1B; bacterial cell WALL synt 97.97
3a3d_A453 PBP4, penicillin-binding protein 4; DACB, hydrolase; 1. 99.46
1w5d_A462 Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidas 99.38
2ex2_A458 Penicillin-binding protein 4; cephem, penem, D- alanyl- 99.24
1w79_A489 D-alanyl-D-alanine carboxypeptidase; penicillin-binding 99.12
3i7j_A280 Beta-lactamase MB2281C; alpha-beta protein., structural 98.71
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 98.56
2ffy_A358 Beta-lactamase; AMPC, deacylation, transition state, bo 98.52
1zkj_A359 CMY-10, extended-spectrum beta-lactamase; plasmid, clas 98.41
2qmi_A447 PBP related beta-lactamase; PAB87, octamer, LU-HPDO3A, 98.32
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 98.32
2wzx_A371 Beta-lactamase; inhibitor, hydrolase, antibiotic resist 98.31
2qz6_A358 Beta-lactamase; psychrophIle, cold adaptation, antibiot 98.3
3ozh_A351 Beta-lactamase/D-alanine carboxypeptidase; structural g 98.28
2drw_A363 DAA, D-amino acid amidase; penicillin recognizing prote 98.19
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 98.07
1ei5_A 520 D-aminopeptidase, DAP; penicillin binding protein, alph 98.07
3oc2_A564 Penicillin-binding protein 3; structu genomics, oxford 97.91
2dcf_A392 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1.40A { 97.75
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 97.15
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 95.94
2jch_A720 Penicillin-binding protein 1B; peptidoglycan synthesis 95.94
1ci9_A392 ESTB, protein (carboxylesterase); hydrolase, caboxylest 98.36
3hlc_A432 Transesterase, LOVD; alpha/beta hydrolase fold, transfe 97.63
1qme_A 702 Penicillin-binding protein 2X; peptidoglycan synthesis, 98.06
3equ_A542 PBP-2, penicillin-binding protein 2; class B transpepti 97.85
1vqq_A646 Saupbp2A, penicillin-binding protein MECA, low-affinity 97.56
>3hun_A Penicillin-binding protein 4; ampicillin, beta-lactamase, serine type D-Ala, D-Ala-carboxypeptidase, antibiotics; HET: ZZ7; 2.00A {Staphylococcus aureus} PDB: 3hum_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=523.84  Aligned_cols=246  Identities=24%  Similarity=0.307  Sum_probs=231.0

Q ss_pred             CCCEEEEECCCCEEEEECCCCCC-CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCC----CCCCCCCCCCCEEE
Q ss_conf             63199999889628311369988-88138799999999997555898855411153676124----54432257885688
Q gi|254780698|r   53 KYSSIVIDVNKNQMTGFKQDEPR-YPASLTKMMTLYIIFEYLQSKKLHLNTQIPVSKTAATQ----NPSKLYLKEKTYFT  127 (336)
Q Consensus        53 ~~sAiv~D~~tG~ILy~Kn~~~~-~PASlTKlMTa~v~le~i~~g~i~~~~~v~is~~a~~~----~~s~~~l~~g~~~t  127 (336)
                      +.+|||||++||+|||+||++++ +|||+|||||+|+++|++++|+++|+++|++|++++..    ++|.+++++|+++|
T Consensus        70 a~sail~da~tG~iLy~KN~d~~~~pASlTKlMTa~l~le~i~~g~l~ld~~vtis~~a~~~~~~~~~S~~~l~~G~~~t  149 (453)
T 3hun_A           70 EPTSAVNVSQTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKLYPGQVWT  149 (453)
T ss_dssp             CCSEEEEEETTSBEEEEESTTCCBCCGGGHHHHHHHHHHHHHHTTSSCTTCEEECCHHHHHHTTCTTCCCCCCCTTCEEE
T ss_pred             CCEEEEEECCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCEEECCCCEEE
T ss_conf             76179999899949335784988584499999999999999863798821256689999985258887621452897988


Q ss_pred             EEHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCEECCCCCCC--------------CCCCCCHHH
Q ss_conf             302457889987777765455420100578999888768872661222002454333--------------344530134
Q gi|254780698|r  128 TEQGILALITRSANDVSTAFGEFISGSEKKFAILMSNKAKKIGMQNTIYKNASGLHD--------------KNQITTARD  193 (336)
Q Consensus       128 v~dLl~~lli~S~NdAa~alAe~i~Gs~~~Fv~~MN~~A~~lGl~~t~f~np~Gl~~--------------~~~~tta~D  193 (336)
                      ++|||+++|+.|+||||++|||+++|++++|+++||++|++|||++|||.||+||++              ++|+|||+|
T Consensus       150 v~dLL~~lli~SaNdAA~aLAe~i~Gs~~~Fv~~MN~kAkeLGm~~T~F~Np~GL~~~~~~~~~~~~~~~~~~~~tTA~D  229 (453)
T 3hun_A          150 IADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIGMKNTHFVNPTGAENSRLRSFAPTKYKDQERTVTTARD  229 (453)
T ss_dssp             HHHHHHHHHHSCCHHHHHHHHHHHSSSHHHHHHHHHHHHHHHTCTTCBCSSSSCSCHHHHGGGSCGGGTTCCCCBBCHHH
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             99999876774427999999998189899999999999998389887666788887644443455444333430510999


Q ss_pred             HHHHHHHHCCCCEEEEEEEEEEEEEECCEEEEEECHHCC----CCCCCEEEEECCCCCCCCEEEEEEEECCEEEEEEEEC
Q ss_conf             555554201362046776115654347869972101025----7687005652242333717999999789799999817
Q gi|254780698|r  194 QAILGILLRKNFPQYYKYFSIRKFRYRNRIITNHNKLLN----KMHNIDGIKTGYTRNSGFNIVTSLRYKDDPIVAVVMG  269 (336)
Q Consensus       194 la~l~~~~~~~~p~~~~~~s~~~~~~~~~~~~n~N~lL~----~~~g~~G~KTG~T~~AG~clv~~a~~~g~~lI~Vvlg  269 (336)
                      |++|++++++++|++++++++..++++..++.|+|.+|.    .|+|+||+|||||++||+|||++++|||+|+|+||||
T Consensus       230 la~l~~~~~~~~p~~~~~~~~~~~~~~~~~~~n~N~~l~~~~~~~~gvdGlKTG~T~~AG~~lv~sa~r~g~~lI~Vvlg  309 (453)
T 3hun_A          230 YAILDLHVIKETPKILDFTKQLAPTTHAVTYYTFNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMG  309 (453)
T ss_dssp             HHHHHHHHHHHCTTHHHHHTCSSCEETTEECCCSCTTSTTSTTCCTTEEEEEEEEETTTEEEEEEEEEETTEEEEEEEEE
T ss_pred             HHHHHHHHHHHCCCHHHHCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEEEEECCEEEEEEEEC
T ss_conf             99999998763730121014750002765640112355566567777422021120357553999999999899999969


Q ss_pred             CCC------HHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             998------78999999999999840154034320
Q gi|254780698|r  270 MPT------SQERDQKALELITSFLEKKTLKHQQT  298 (336)
Q Consensus       270 ~~s------~~~R~~~~~~Ll~~~f~~~~~~~~~~  298 (336)
                      +++      +..||.|+++||||+|++|..+....
T Consensus       310 a~~~~~~~~~~~R~~d~~~Lldy~f~~f~~~~l~~  344 (453)
T 3hun_A          310 AGDYKNLGGEKQRNMMGNALMERSFDQYKYVKILS  344 (453)
T ss_dssp             ESBTTTTBCHHHHHHHHHHHHHHHHHHEEEEEEEC
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCEEEEEEC
T ss_conf             89866544488899999999999885126999854



>3ita_A D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-binding protein, BP6, DD-carboxypeptidase, peptidoglycan, ampicillin, acyl-enzyme complex; HET: AIX AIC; 1.80A {Escherichia coli} PDB: 3it9_A* 3itb_A* Back     alignment and structure
>1z6f_A Penicillin-binding protein 5; peptidoglycan synthesis, DD- carboxypeptidase, hydrolase, boronic acid; HET: BO9; 1.60A {Escherichia coli} SCOP: b.105.1.1 e.3.1.1 PDB: 1nzu_A 1nzo_A* 3beb_A* 3bec_A* 1nj4_A 1hd8_A 1sdn_A Back     alignment and structure
>3a3j_A PBP5; penicillin binding protein 5, DACA, hydrolase; 2.15A {Haemophilus influenzae} Back     alignment and structure
>1xp4_A D-alanyl-D-alanine carboxypeptidase; five-stranded antiparallel beta-sheet, omega-like loop, hydrolase; 2.80A {Streptococcus pneumoniae R6} SCOP: b.105.1.1 e.3.1.1 Back     alignment and structure
>1tvf_A PBP4, penicillin binding protein 4; structural genomics, nysgxrc target, SAV0642, PSI, protein structure initiative; 2.00A {Staphylococcus aureus} SCOP: b.105.1.2 e.3.1.1 Back     alignment and structure
>3mfd_A D-alanyl-D-alanine carboxypeptidase DACB; penicillin-binding protein 5*, beta-lactamase, structural GE PSI-2, protein structure initiative; HET: CIT; 1.75A {Bacillus subtilis} Back     alignment and structure
>1es5_A DD-transpeptidase; penicillin-binding, serine peptidase, beta-lactamase, hydrolase carboxypeptidase; 1.40A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1skf_A 1es2_A 1j9m_A 1esi_A 1es3_A 1es4_A Back     alignment and structure
>2bcf_A Probable D-alanyl-D-alanine carboxypeptidase DACB2; penicillin-binding protein, DD-2 carboxypeptidase, directed evolution; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1w7f_A Beta-lactamase; hydrolase, isocitrate, bacillus licheniformis hydrolase; HET: ICT; 1.80A {Bacillus licheniformis} Back     alignment and structure
>2cc1_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, broad-spectrum; 2.13A {Mycobacterium fortuitum} SCOP: e.3.1.1 Back     alignment and structure
>3dw0_A Class A carbapenemase KPC-2; beta-lactamase, antibiotic resistance, hydrolase; 1.60A {Escherichia coli} Back     alignment and structure
>2j9o_A TLL2115 protein; penicillin-binding protein, hydrolase, lactamase, thioesterase, DD-peptidase; 1.50A {Synechococcus elongatus} PDB: 2jbf_A* 2j7v_A 2j8y_A* Back     alignment and structure
>1n9b_A Penicillinase, beta-lactamase SHV-2; beta-lactam hydrolase, detergent binding, drug design, radiation damage; HET: MA4 EPE; 0.90A {Klebsiella pneumoniae} SCOP: e.3.1.1 PDB: 3d4f_A* 2zd8_A* 1q2p_A* 1shv_A* 1vm1_A* 2g2u_A 2h5s_A* 1ong_A* 3c4o_A 3c4p_A 2a3u_A* 1tdg_A* 1tdl_A* 2a49_A* 2g2w_A 1rcj_A* 2h0t_A* 2h0y_A* 2h10_A* Back     alignment and structure
>2wk0_A Beta-lactamase; hydrolase, iodopenicillanate, antibiotic resistance; HET: BIY CIT; 1.65A {Bacillus licheniformis} PDB: 3b3x_A* 1i2s_A* 1i2w_A* 2blm_A 4blm_A 1mbl_A Back     alignment and structure
>1o7e_A L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrophomonas maltophilia} SCOP: e.3.1.1 PDB: 1n4o_A Back     alignment and structure
>3c5a_A Class A carbapenemase KPC-2; beta-lactamase, C-terminal deleted mutant, plasmid, hydrolase; HET: CIT; 1.23A {Escherichia coli} PDB: 2ods_A 2ov5_A* 3e2k_A 3e2l_A* Back     alignment and structure
>3p09_A Beta-lactamase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich, cytosol; HET: MSE; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>1hzo_A Beta-lactamase; mixed alpha/beta, cephalosporinase, hydrolase; HET: MES; 1.75A {Proteus vulgaris} SCOP: e.3.1.1 Back     alignment and structure
>1g6a_A Beta-lactamase PSE-4; class A beta-lactamase, carbenicillinase, R234K mutant, hydrolase; 1.75A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1g68_A Back     alignment and structure
>1bsg_A Beta lactamase, penicillinase; hydrolase, antibiotic resistance; 1.85A {Streptomyces albus G} SCOP: e.3.1.1 Back     alignment and structure
>1e25_A Extended-spectrum beta-lactamase PER-1; hydrolase, antibiotic resistance, class A cephalosporinase; 1.9A {Pseudomonas aeruginosa} SCOP: e.3.1.1 Back     alignment and structure
>3cjm_A Putative beta-lactamase; NP_815223.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 1.50A {Enterococcus faecalis V583} Back     alignment and structure
>1ghp_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, beta-lactam hydrolysis, benzylpenicillin, cephaloridine; HET: PNM; 1.76A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1ghi_A* 1ghm_A* 1kgf_A 1kge_A 1ome_A 1kgg_A 1dja_A 3blm_A 1blh_A* 1blc_A 1djc_A 1djb_A 1blp_A 1pio_A Back     alignment and structure
>3hbr_A OXA-48; class D beta-lactamase, antibiotic, dimer, hydrolase; HET: KCX; 1.90A {Klebsiella pneumoniae} Back     alignment and structure
>1yqs_A D-alanyl-D-alanine carboxypeptidase; cell well biosynthesis, beta-lactam, beta-sultam, sulfonylation, hydrolase; HET: BSA; 1.05A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1cef_A* 1ceg_A* 1ikg_A* 1iki_A* 1hvb_A* 1pw1_A* 1pw8_A* 1mpl_A* 1pwd_A* 1pwc_A* 1scw_A* 1pwg_A* 3pte_A 1sde_A* Back     alignment and structure
>2qpn_A Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1.10A {Klebsiella pneumoniae} Back     alignment and structure
>1m40_A TEM-1, beta-lactamase TEM; acylation mechanism, ultra- high resolution, hydrolase; HET: CB4; 0.85A {Escherichia coli} SCOP: e.3.1.1 PDB: 1jwp_A* 1nxy_A* 1ny0_A* 1nym_A* 1nyy_A* 1pzo_A* 1erm_A* 1ero_A* 1erq_A* 1s0w_A 1xpb_A 1li0_A 1htz_A 1jtd_A 1esu_A 1jwz_A* 1li9_A 1jwv_A* 1jtg_A 1axb_A* ... Back     alignment and structure
>3m6b_A Beta-lactamase, penicillinase; alpha-beta structure, antibiotic resistance, cell membrane, hydrolase, lipoprotein, membrane; HET: 1RG; 1.30A {Mycobacterium tuberculosis} PDB: 3dwz_A* 3iqa_A* 3cg5_A* 3m6h_A* 2gdn_A Back     alignment and structure
>2p74_A Beta-lactamase CTX-M-9A; ultra-high resolution, acylation, ESBL, hydrolase; HET: PO4; 0.88A {Escherichia coli} PDB: 3g2y_A* 1ylj_A* 1yly_A* 1ym1_A* 1yms_A* 1ymx_A* 3g2z_A* 3g30_A* 3g31_A* 3g32_A* 3g34_A* 3g35_A* 1ylt_A* 1ylz_A* 3hre_A 3hlw_A 3huo_A* 3hvf_A* 1ylw_A 1ylp_A* ... Back     alignment and structure
>1bue_A Protein (imipenem-hydrolysing beta-lactamase); hydrolase, antibiotic resistance, class A carbapenemase; 1.64A {Enterobacter cloacae} SCOP: e.3.1.1 PDB: 1bul_A* 1dy6_A Back     alignment and structure
>3lez_A Beta-lactamase; antibiotic resistance, halotolerant, DEEP- SEA bacterium, hydrolase; HET: EPE; 1.25A {Oceanobacillus iheyensis} Back     alignment and structure
>1alq_A CP254 beta-lactamase; hydrolase, circular permuted, antibiotic resistance; 1.80A {Staphylococcus aureus} SCOP: e.3.1.1 Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Back     alignment and structure
>1nrf_A Regulatory protein BLAR1; penicillin-receptor, beta-lactamase induction, penicillin-binding protein, membrane protein; 2.50A {Bacillus licheniformis} SCOP: e.3.1.1 Back     alignment and structure
>2iwb_A Methicillin resistance MECR1 protein; antibiotic resistance, bacterial antibiotic resistance, methicillin resistance, beta-lactamic antibiotics, MRSA; 1.8A {Staphylococcus aureus} PDB: 2iwc_A* 2iwd_A* Back     alignment and structure
>1k38_A Penicillinase, beta-lactamase OXA-2; serine beta-lactamase, hydrolase, antibiotic resistance, carbamylated lysine; HET: KCX; 1.50A {Salmonella typhimurium} SCOP: e.3.1.1 PDB: 3if6_A* Back     alignment and structure
>1k55_A Beta lactamase OXA-10; antibiotic resistance, carbamylation, hydrolase; HET: KCX SO4; 1.39A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1e4d_A* 1ewz_A 1k54_A* 1e3u_A* 1k56_A* 1k57_A* 3lce_A* 1k4f_A* 1k4e_A* 1k6r_A* 1k6s_A* 2wgv_A* 2wgw_A* 1fof_A 1e3u_D 2hpb_A 2hp9_A 2hp6_A 2wgi_A* 2rl3_A* ... Back     alignment and structure
>1xkz_A Regulatory protein BLAR1; beta-lactam receptor, signal transduction, signaling protein; HET: CAZ EPE; 1.75A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1xa1_A* 1xa7_A* Back     alignment and structure
>3g4p_A Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme mechanism, carbapenem, resistance, hydrolase; HET: KCX; 1.97A {Acinetobacter baumannii} PDB: 2jc7_A* 3fyz_A* 3fzc_A* 3fv7_A* Back     alignment and structure
>3isg_A Penicillinase, beta-lactamase OXA-1; hydrolase, lysine carboxylation, antibiotic resistance, plasmid, transposable element; HET: KCX DRW; 1.40A {Escherichia coli} PDB: 1m6k_A* Back     alignment and structure
>3fwm_A Penicillin-binding protein 1B; bacterial cell WALL synthesis, antibiotics design, transferase, hydrolase; HET: M0E; 2.16A {Escherichia coli} PDB: 3fwl_A* Back     alignment and structure
>3a3d_A PBP4, penicillin-binding protein 4; DACB, hydrolase; 1.60A {Haemophilus influenzae} PDB: 3a3e_A* 3a3f_A* 3a3i_A* Back     alignment and structure
>1w5d_A Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidase, peptidoglycan, beta-lactam, hydrolase, peptidoglycan synthesis; 2.1A {Bacillus subtilis} SCOP: e.3.1.3 PDB: 2j9p_A* Back     alignment and structure
>2ex2_A Penicillin-binding protein 4; cephem, penem, D- alanyl-D-alanine-carboxypeptidase, D-alanyl-D-alanine- endopeptidase, hydrolase; 1.55A {Escherichia coli} SCOP: e.3.1.3 PDB: 2ex6_A* 2ex8_A* 2ex9_A* 2exa_A* 2exb_A* Back     alignment and structure
>1w79_A D-alanyl-D-alanine carboxypeptidase; penicillin-binding, peptidoglycan, transpeptidase, antibiotic resistance, hydrolase; 1.8A {Actinomadura SP} SCOP: e.3.1.3 PDB: 1w8q_A 1w8y_A* 2vgj_A* 2vgk_A* 2wke_A* Back     alignment and structure
>3i7j_A Beta-lactamase MB2281C; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 2.20A {Mycobacterium bovis} Back     alignment and structure
>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A Back     alignment and structure
>2ffy_A Beta-lactamase; AMPC, deacylation, transition state, boronic acid, hydrolase; HET: SM3; 1.07A {Escherichia coli} SCOP: e.3.1.1 PDB: 1pi5_A* 1pi4_A* 2hds_A* 1c3b_A* 1fco_A* 1ga9_A* 1iem_A* 1kds_A* 1kdw_A* 1ke0_A* 1ke3_A* 1iel_A 1kvm_A* 1l2s_A* 1ll5_A* 1ll9_A* 1llb_A* 1mxo_A* 1my8_A* 1xgi_A* ... Back     alignment and structure
>1zkj_A CMY-10, extended-spectrum beta-lactamase; plasmid, class C, hydrolase; 1.55A {Enterobacter aerogenes} Back     alignment and structure
>2qmi_A PBP related beta-lactamase; PAB87, octamer, LU-HPDO3A, archaea, hydrolase; HET: DO3; 2.20A {Pyrococcus abyssi} Back     alignment and structure
>2v2f_F Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Back     alignment and structure
>2wzx_A Beta-lactamase; inhibitor, hydrolase, antibiotic resistance; HET: ZX0; 1.40A {Pseudomonas aeruginosa} PDB: 2wzz_A* Back     alignment and structure
>2qz6_A Beta-lactamase; psychrophIle, cold adaptation, antibiotic resistance, hydrolase, periplasm; 2.26A {Pseudomonas fluorescens} Back     alignment and structure
>3ozh_A Beta-lactamase/D-alanine carboxypeptidase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich; 1.91A {Yersinia pestis} Back     alignment and structure
>2drw_A DAA, D-amino acid amidase; penicillin recognizing protein, D-stereospecific, hydrophobic, hydrolase; 2.10A {Ochrobactrum anthropi} SCOP: e.3.1.1 PDB: 2dns_A 2efu_A* 2efx_A* Back     alignment and structure
>3lo7_A PBPA, penicillin-binding protein A; transpeptidase domain, cell membrane, cell shape, cell WALL biogenesis/degradation, membrane; 2.05A {Mycobacterium tuberculosis} Back     alignment and structure
>1ei5_A D-aminopeptidase, DAP; penicillin binding protein, alpha/beta domain, beta barrel domain, hydrolase; 1.90A {Ochrobactrum anthropi} SCOP: b.61.3.1 b.61.3.1 e.3.1.1 Back     alignment and structure