254780707

254780707

putative phosphate-binding periplasmic protein

GeneID in NCBI database:8209711Locus tag:CLIBASIA_02970
Protein GI in NCBI database:254780707Protein Accession:YP_003065120.1
Gene range:+(558762, 559802)Protein Length:346aa
Gene description:putative phosphate-binding periplasmic protein
COG prediction:[P] ABC-type phosphate transport system, periplasmic component
KEGG prediction:putative phosphate-binding periplasmic protein; K02040 phosphate transport system substrate-binding protein
SEED prediction:Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Two-component system [PATH:las02020]
Subsystem involved in SEED:High affinity phosphate transporter and control of PHO regulon;
Phosphate metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG
ccHHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHccccccEEcccccccHHHHHHHHHcccccccEEEEEccEEEEEEccccccccccHHHHHHHHHHcccccccEEccccccHHHHccccccccEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHccccccEEEEEHHHHHcccccEEccccccccccHHHccccccccEEEEEEEEccccccccHHHHHHHHHHHcHHHHccccHHHHcccccccHHHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHccccccccccccccccccHHHHHHHHHccccccEEEEEEEEEEEEEEccccccccccHHHHHHHHHccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHcccccEEcccccccHHHHHHccccccEEEEEHHEHHcccccEEEEEcccccccHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHHHHHccccccHHHcccccccHHHHHHHHHHHHccccc
MRFFFVVLMCFVVLEVYCgtgtfarnririagsstlfpySKIIAENfseyfpefktpfvesggssvglkefcrgigddtidIVNSSRKITQNELDEckkhgvsdiqevtighdgillvsdrdmvsVSLTVEDLYKALASYLIVDdkvvfnplkkwseirpdfpevriaiyvpsgkhgtreVLEKKVlqegcvrsrnfskmRDMFKYNVQQLSVACTsvrqdgiaievdgdytETLARIEVNKDVFGFVGLSfyknnadvlklvpidgivpsmgtivsglypisrplLFYVKRQHFNSVLGLREYVsfsvsdemmapdsqlfqyglipisneerksvrdsiavgksg
MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKkwseirpdfpevRIAIYvpsgkhgtrevlekkvlqegcvrsrnfskmrDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGlipisneerksvrdsiavgksg
MRfffvvlmcfvvlevYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG
***FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFK***********GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA*G***
MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER*************
MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG
MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG
MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target346 putative phosphate-binding periplasmic protein [Candida
315121872355 putative phosphate-binding periplasmic protein [Candida 1 1e-158
15964262344 putative phosphate-binding periplasmic protein [Sinorhi 1 1e-101
86356163344 phosphate ABC transporter, substrate-binding protein [R 1 1e-100
116250314344 solute-binding component of ABC transporter [Rhizobium 1 1e-100
150395347344 putative phosphate-binding periplasmic protein [Sinorhi 1 1e-100
190890212344 phosphate ABC transporter substrate-binding protein [Rh 1 1e-100
209547777344 phosphate ABC transporter substrate-binding protein [Rh 1 1e-100
241202932344 phosphate ABC transporter substrate-binding protein [Rh 1 1e-100
327192732366 phosphate ABC transporter, substrate-binding protein [R 1 1e-100
227820729344 predicted phosphate ABC transporter, substrate-binding 1 6e-99
>gi|315121872|ref|YP_004062361.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 355 Back     alignment and organism information
 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/345 (77%), Positives = 310/345 (89%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MRFFFVV+ CFV    YCGT  FARNRIRIAGSST FPYSKIIAENFSEYFPEFKTPFVE
Sbjct: 1   MRFFFVVITCFVFWTTYCGTEIFARNRIRIAGSSTFFPYSKIIAENFSEYFPEFKTPFVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLKEFC+GIG+DTIDIVNSSRKITQ+ELDECKK GVS+IQEVTIG+DGI+LVSD
Sbjct: 61  SGGSSAGLKEFCKGIGEDTIDIVNSSRKITQSELDECKKKGVSEIQEVTIGYDGIVLVSD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++MV+VSLT+EDLYKALAS LIV+  +V NP KKWS+IR D P++RI+IYVPS KHGTRE
Sbjct: 121 KNMVNVSLTIEDLYKALASKLIVNGLLVSNPFKKWSDIRSDLPKIRISIYVPSEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           ++E+KVL+EGCVRS NFSKMRD+FK+N  Q+ +ACT VR+DG+AIEVDGDYTETLARIEV
Sbjct: 181 IIEQKVLREGCVRSGNFSKMRDIFKHNASQVDMACTFVRKDGVAIEVDGDYTETLARIEV 240

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NKD+FGF+GLSFYKNNAD+L LV IDG++PS+ TI+SG+YPISRPLLFYVK+ HF +VLG
Sbjct: 241 NKDIFGFLGLSFYKNNADILNLVSIDGVIPSVDTILSGVYPISRPLLFYVKKSHFINVLG 300

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           LREYVSFS+SDEMM   SQL QYGLIPI N++RK V+DSIA+ K+
Sbjct: 301 LREYVSFSLSDEMMDSGSQLIQYGLIPIPNKDRKIVQDSIAIEKN 345


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964262|ref|NP_384615.1| putative phosphate-binding periplasmic protein [Sinorhizobium meliloti 1021] Length = 344 Back     alignment and organism information
>gi|86356163|ref|YP_468055.1| phosphate ABC transporter, substrate-binding protein [Rhizobium etli CFN 42] Length = 344 Back     alignment and organism information
>gi|116250314|ref|YP_766152.1| solute-binding component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 344 Back     alignment and organism information
>gi|150395347|ref|YP_001325814.1| putative phosphate-binding periplasmic protein [Sinorhizobium medicae WSM419] Length = 344 Back     alignment and organism information
>gi|190890212|ref|YP_001976754.1| phosphate ABC transporter substrate-binding protein [Rhizobium etli CIAT 652] Length = 344 Back     alignment and organism information
>gi|209547777|ref|YP_002279694.1| phosphate ABC transporter substrate-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 344 Back     alignment and organism information
>gi|241202932|ref|YP_002974028.1| phosphate ABC transporter substrate-binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 344 Back     alignment and organism information
>gi|327192732|gb|EGE59668.1| phosphate ABC transporter, substrate-binding protein [Rhizobium etli CNPAF512] Length = 366 Back     alignment and organism information
>gi|227820729|ref|YP_002824699.1| predicted phosphate ABC transporter, substrate-binding protein [Sinorhizobium fredii NGR234] Length = 344 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target346 putative phosphate-binding periplasmic protein [Candida
TIGR02136287 TIGR02136, ptsS_2, phosphate binding protein 2e-29
COG0226318 COG0226, PstS, ABC-type phosphate transport system, per 5e-31
>gnl|CDD|162722 TIGR02136, ptsS_2, phosphate binding protein Back     alignment and domain information
>gnl|CDD|30575 COG0226, PstS, ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 346 putative phosphate-binding periplasmic protein [Candida
COG0226318 PstS ABC-type phosphate transport system, periplasmic c 100.0
PRK10918346 phosphate transporter subunit; Provisional 100.0
TIGR02136308 ptsS_2 phosphate binding protein; InterPro: IPR011862 M 99.92
COG0725258 ModA ABC-type molybdate transport system, periplasmic c 99.37
PRK10677257 modA molybdate transporter periplasmic protein; Provisi 99.27
TIGR00975324 3a0107s03 phosphate ABC transporter, phosphate-binding 99.21
TIGR03227367 PhnS 2-aminoethylphosphonate ABC transporter, periplasm 99.13
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transport sy 99.04
PRK10852338 thiosulfate transporter subunit; Provisional 98.85
COG1613348 Sbp ABC-type sulfate transport system, periplasmic comp 98.62
CHL00180307 rbcR LysR transcriptional regulator; Provisional 98.43
PRK11242292 DNA-binding transcriptional regulator CynR; Provisional 98.4
PRK10837291 putative DNA-binding transcriptional regulator; Provisi 98.37
COG4588252 AcfC Accessory colonization factor AcfC, contains ABC-t 98.32
PRK09906296 DNA-binding transcriptional regulator HcaR; Provisional 98.21
TIGR03339279 phn_lysR aminoethylphosphonate catabolism associated Ly 98.07
PRK12679316 cbl transcriptional regulator Cbl; Reviewed 98.06
PRK09501348 potD spermidine/putrescine ABC transporter periplasmic 98.03
pfam03466209 LysR_substrate LysR substrate binding domain. The struc 98.03
PRK12683308 transcriptional regulator CysB-like protein; Reviewed 97.98
PRK12684313 transcriptional regulator CysB-like protein; Reviewed 97.9
COG4150341 CysP ABC-type sulfate transport system, periplasmic com 97.83
PRK09986278 DNA-binding transcriptional activator XapR; Provisional 97.74
PRK12682309 transcriptional regulator CysB-like protein; Reviewed 97.58
COG1840299 AfuA ABC-type Fe3+ transport system, periplasmic compon 97.57
PRK11151305 DNA-binding transcriptional regulator OxyR; Provisional 97.27
TIGR01256225 modA molybdate ABC transporter, periplasmic molybdate-b 97.2
PRK11233305 nitrogen assimilation transcriptional regulator; Provis 96.98
COG1910223 Periplasmic molybdate-binding protein/domain [Inorganic 96.57
TIGR00971320 3a0106s03 sulfate ABC transporter, sulfate-binding prot 95.84
PRK10341312 DNA-binding transcriptional activator TdcA; Provisional 95.62
COG0687363 PotD Spermidine/putrescine-binding periplasmic protein 92.92
PRK04168336 hypothetical protein; Provisional 99.24
PRK03601275 transcriptional regulator HdfR; Provisional 97.53
PRK10974439 glycerol-3-phosphate transporter periplasmic binding pr 97.45
COG4143336 TbpA ABC-type thiamine transport system, periplasmic co 97.31
PRK11716269 DNA-binding transcriptional regulator IlvY; Provisional 96.91
PRK09495247 glnH glutamine ABC transporter periplasmic protein; Rev 96.77
PRK09474394 malE maltose ABC transporter periplasmic protein; Revie 96.56
PRK10682370 putrescine transporter subunit: periplasmic-binding com 96.44
PRK09791302 putative DNA-binding transcriptional regulator; Provisi 96.04
PRK11260264 cystine transporter subunit; Provisional 95.36
PRK10797302 glutamate and aspartate transporter subunit; Provisiona 94.79
PRK11139295 DNA-binding transcriptional activator GcvA; Provisional 94.21
PRK09701311 D-allose transporter subunit; Provisional 90.9
PRK10752329 sulfate transporter subunit; Provisional 98.78
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phosphona 97.55
PRK03537188 hypothetical protein; Provisional 97.21
PRK11205326 tbpA thiamine transporter substrate binding subunit; Pr 97.95
pfam01547260 SBP_bac_1 Bacterial extracellular solute-binding protei 97.49
COG1653433 UgpB ABC-type sugar transport system, periplasmic compo 97.3
PRK11553314 alkanesulfonate transporter substrate-binding subunit; 96.97
COG2998280 TupB ABC-type tungstate transport system, permease comp 97.47
PRK12681324 cysB transcriptional regulator CysB; Reviewed 97.19
COG2358321 Imp TRAP-type uncharacterized transport system, peripla 96.57
PRK12680327 transcriptional regulator CysB-like protein; Reviewed 94.97
PRK11013309 DNA-binding transcriptional regulator LysR; Provisional 93.68
COG2182420 MalE Maltose-binding periplasmic proteins/domains [Carb 94.85
>COG0226 PstS ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10918 phosphate transporter subunit; Provisional Back     alignment and domain information
>TIGR02136 ptsS_2 phosphate binding protein; InterPro: IPR011862 Members of this family are phosphate-binding proteins Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>TIGR00975 3a0107s03 phosphate ABC transporter, phosphate-binding protein PstS; InterPro: IPR005673 This family represents a sub-group of the phosphate-binding periplasmic proteins, one of the bacterial proteins required for binding-protein-mediated phosphate transport Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>PRK10837 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG4588 AcfC Accessory colonization factor AcfC, contains ABC-type periplasmic domain [General function prediction only] Back     alignment and domain information
>PRK09906 DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>pfam03466 LysR_substrate LysR substrate binding domain Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>COG4150 CysP ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate ABC transporter, sulfate-binding protein; InterPro: IPR005669 Thiosulphate-binding proteins (gene cysP) specifically binds thiosulphate and are involved in the transport systems for this nutrients , Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04168 hypothetical protein; Provisional Back     alignment and domain information
>PRK03601 transcriptional regulator HdfR; Provisional Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11139 DNA-binding transcriptional activator GcvA; Provisional Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>PRK03537 hypothetical protein; Provisional Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>pfam01547 SBP_bac_1 Bacterial extracellular solute-binding protein Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Back     alignment and domain information
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PRK12680 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target346 putative phosphate-binding periplasmic protein [Candida
2z22_X321 Crystal Structure Of Phosphate Preplasmic Binding P 5e-25
1a54_A321 Phosphate-Binding Protein Mutant A197c Labelled Wit 4e-24
2abh_A321 Phosphate-Binding Protein (Re-Refined) Length = 321 4e-24
1ixh_A321 Phosphate-Binding Protein (Pbp) Complexed With Phos 4e-24
1a40_A321 Phosphate-Binding Protein With Ala 197 Replaced Wit 5e-24
1qul_A321 Phosphate-Binding Protein Mutant With Asp 137 Repla 5e-24
1quk_A321 Phosphate-Binding Protein Mutant With Asp 137 Repla 7e-24
1qui_A321 Phosphate-Binding Protein Mutant With Asp 137 Repla 1e-23
1oib_A321 Phosphate-Binding Protein Mutant T141d Length = 321 1e-23
1ixg_A321 Phosphate-Binding Protein Mutant With Thr 141 Repla 1e-23
1ixi_A321 Phosphate-Binding Protein Mutant With Asp 56 Replac 2e-23
1twy_A290 Crystal Structure Of An Abc-Type Phosphate Transpor 3e-23
1pc3_B350 Crystal Structure Of The Extracellular Phosphate Ab 2e-13
>gi|159795673|pdb|2Z22|X Chain X, Crystal Structure Of Phosphate Preplasmic Binding Protein Psts From Yersinia Pestis Length = 321 Back     alignment and structure
 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 44/325 (13%), Positives = 94/325 (28%), Gaps = 26/325 (8%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            +  AG++   P     A+++ +          +  GSS G+K+        T+D   S 
Sbjct: 3   SLTGAGATFPAPVYAKWADSYQKETGNK--INYQGIGSSGGVKQIIAN----TVDFGASD 56

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
             +T  +L          + +      G++L  +   +       D  K L    +   K
Sbjct: 57  APLTDEKLA------TEGLFQFPTVIGGVVLAVNIPGIKSGELTLDG-KTLGDIYLGTVK 109

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK---VLQEGCVRSRNFSKMRDM 203
              +P           P+  IA+   +   GT  V       V  E   +    S +   
Sbjct: 110 KWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWP 169

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                +        V++   +I            +   K +           ++      
Sbjct: 170 TGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAK 229

Query: 264 PIDGIVPSMG--TIVSGL--YPISRPLLFYVKRQHFNSVLG--LREYVSFSVSDEMMAPD 317
            +D         T   G   +PI+      V ++  N+  G  + ++  +  +      +
Sbjct: 230 GVDWSKSFAQDLTNQKGDDVWPITSTTFILVHKEQKNAANGTEVLKFFDWGYTHGAKQAN 289

Query: 318 SQLFQYGLIPISNEERKSVRDSIAV 342
               +     +  E  + VR +   
Sbjct: 290 ----ELDYATLPAEVVEQVRAAWKT 310


>gi|3892021|pdb|1A54|A Chain A, Phosphate-Binding Protein Mutant A197c Labelled With A Coumarin Fluorophore And Bound To Dihydrogenphosphate Ion Length = 321 Back     alignment and structure
>gi|157834526|pdb|2ABH|A Chain A, Phosphate-Binding Protein (Re-Refined) Length = 321 Back     alignment and structure
>gi|157831527|pdb|1IXH|A Chain A, Phosphate-Binding Protein (Pbp) Complexed With Phosphate Length = 321 Back     alignment and structure
>gi|157829674|pdb|1A40|A Chain A, Phosphate-Binding Protein With Ala 197 Replaced With Trp Length = 321 Back     alignment and structure
>gi|157833616|pdb|1QUL|A Chain A, Phosphate-Binding Protein Mutant With Asp 137 Replaced By Thr Complex With Chlorine And Phosphate Length = 321 Back     alignment and structure
>gi|157833615|pdb|1QUK|A Chain A, Phosphate-Binding Protein Mutant With Asp 137 Replaced By Asn Complex With Phosphate Length = 321 Back     alignment and structure
>gi|157833613|pdb|1QUI|A Chain A, Phosphate-Binding Protein Mutant With Asp 137 Replaced By Gly Complex With Bromine And Phosphate Length = 321 Back     alignment and structure
>gi|2098315|pdb|1OIB|A Chain A, Phosphate-Binding Protein Mutant T141d Length = 321 Back     alignment and structure
>gi|157831526|pdb|1IXG|A Chain A, Phosphate-Binding Protein Mutant With Thr 141 Replaced By Asp (T141d), Complexed With Phospate Length = 321 Back     alignment and structure
>gi|157831528|pdb|1IXI|A Chain A, Phosphate-Binding Protein Mutant With Asp 56 Replaced By Asn Complex With Monobasic Phosphate Ion Length = 321 Back     alignment and structure
>gi|58176860|pdb|1TWY|A Chain A, Crystal Structure Of An Abc-Type Phosphate Transport Receptor From Vibrio Cholerae Length = 290 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target346 putative phosphate-binding periplasmic protein [Candida
1pc3_A350 Phosphate-binding protein 1; phosphate transport recept 1e-27
1ixh_A321 Phosphate-binding protein; phosphate transport, ultra h 7e-27
1twy_A290 ABC transporter, periplasmic substrate-binding protein; 2e-19
3g63_A381 Pfluding; subatomic resolution, phosphate binding, DING 3e-16
3cvg_A294 Putative metal binding protein; PSI-II, NYSGXRC, peripl 6e-11
>1ixh_A Phosphate-binding protein; phosphate transport, ultra high resolution, phosphate bindin protein; 0.98A {Escherichia coli} SCOP: c.94.1.1 PDB: 2abh_A 1a54_A* 1a55_A 1ixi_A 1quk_A 1ixg_A 1oib_A 1pbp_A 1qul_A 1qui_A 1quj_A 1a40_A 2z22_X Length = 321 Back     alignment and structure
>1twy_A ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} SCOP: c.94.1.1 Length = 290 Back     alignment and structure
>3g63_A Pfluding; subatomic resolution, phosphate binding, DING protein, hydrogen ATOM, phosphate binding protein; 0.88A {Pseudomonas fluorescens SBW25} PDB: 3g62_A 2q9t_A 2v3q_A 2cap_A Length = 381 Back     alignment and structure
>3cvg_A Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural genomics, protein structure initiative; 1.97A {Coccidioides immitis RS} Length = 294 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target346 putative phosphate-binding periplasmic protein [Candida
1ixh_A321 Phosphate-binding protein; phosphate transport, ultra h 100.0
1pc3_A350 Phosphate-binding protein 1; phosphate transport recept 100.0
3g63_A381 Pfluding; subatomic resolution, phosphate binding, DING 100.0
1twy_A290 ABC transporter, periplasmic substrate-binding protein; 100.0
3cvg_A294 Putative metal binding protein; PSI-II, NYSGXRC, peripl 100.0
2hxw_A237 Major antigenic peptide PEB3; periplasmic binding prote 99.6
1atg_A231 MODA, periplasmic molybdate-binding protein; tungstate, 99.33
3gzg_A253 Molybdate-binding periplasmic protein; permease; molybd 99.21
1amf_A233 Molybdate transport protein MODA; periplasmic, binding 99.21
1sbp_A310 Sulfate-binding protein; 1.70A {Salmonella typhimurium} 98.89
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- bindi 99.02
3kn3_A242 Putative periplasmic protein; alpha-beta structure, per 99.01
3c9h_A355 ABC transporter, substrate binding protein; structural 98.97
3muq_A237 Uncharacterized conserved protein; structural genomics, 98.92
3cg1_A296 UPF0100 protein PF0080; ABC transporter, binding protei 97.81
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR-type 97.24
3k01_A412 Acarbose/maltose binding protein GACH; ABC transporter, 97.24
1pot_A325 POTD, spermidine/putrescine-binding protein; polyamine 97.22
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcription, t 97.21
2v84_A343 Spermidine/putrescine ABC transporter, periplasmic bind 97.08
1i6a_A219 OXYR, hydrogen peroxide-inducible genes activator; OXYR 96.51
1q35_A320 Iron binding protein FBPA; metal binding protein; 1.20A 96.18
1elj_A381 Maltodextrin-binding protein; protein-carbohydrate comp 95.69
3oxn_A241 Putative transcriptional regulator, LYSR family; struct 94.85
2z8f_A412 Galacto-N-biose/lacto-N-biose I transporter substrate-b 93.72
3fzv_A306 Probable transcriptional regulator; LYSR, structural ge 93.36
2xd3_A416 MALX, maltose/maltodextrin-binding protein; solute-bind 93.27
3thi_A371 Protein (thiaminase I); thiamin degradation, transferas 91.07
3cfx_A296 UPF0100 protein MA_0280; ABC transporter, binding prote 98.79
3k6v_A354 Solute-binding protein MA_0280; MODA, molybdate, peripl 98.72
3cij_A295 UPF0100 protein AF_0094; archaeal periplasmic binding p 98.63
2qry_A330 Thiamine-binding periplasmic protein; thiamin binding p 98.02
1nnf_A309 Iron-utilization periplasmic protein; iron-binding prot 97.99
1us5_A314 Putative GLUR0 ligand binding core; receptor, membrane 97.91
2pt1_A334 Iron transport protein; C-clamp, iron-binding protein, 97.64
3cfz_A292 UPF0100 protein MJ1186; ABC transporter, binding protei 97.26
1y9u_A323 Putative iron binding protein; periplasmic binding prot 97.22
2hzl_A365 Trap-T family sorbitol/mannitol transporter, periplasmi 93.15
2fyi_A228 HTH-type transcriptional regulator CBL; Lys-R family, c 98.17
2hxr_A238 HTH-type transcriptional regulator CYNR; CYNR transcrip 97.94
1ixc_A294 CBNR, LYSR-type regulatory protein; long alpha helix co 97.58
2h9b_A312 HTH-type transcriptional regulator BENM; LTTR, transcri 97.51
1al3_A324 Cys regulon transcriptional activator CYSB; LYSR family 97.48
2ql3_A209 Probable transcriptional regulator, LYSR family protein 97.26
2h98_A313 HTH-type transcriptional regulator CATM; BENM, LTTR; 1. 96.82
3fxq_A305 LYSR type regulator of TSAMBCD; transcriptional regulat 96.7
1xvx_A312 YFUA; periplasmic iron binding protein; 1.53A {Yersinia 97.81
3e13_X322 Putative iron-uptake ABC transport system, periplasmic 97.37
2voz_A346 FUTA2, periplasmic iron-binding protein; ferric binding 97.8
1eu8_A409 Trehalose/maltose binding protein; protein-carbohydrate 96.49
1urs_A402 Maltose-binding protein; maltodextrin-binding protein, 96.03
2heu_A401 Sugar ABC transporter, sugar-binding protein; periplasm 95.82
1a99_A344 POTF, putrescine-binding protein; transport, periplasmi 95.28
2zyo_A397 Solute-binding protein; open form, sugar binding protei 94.38
3i3v_A405 Probable secreted solute-binding lipoprotein; transport 96.04
>1ixh_A Phosphate-binding protein; phosphate transport, ultra high resolution, phosphate bindin protein; 0.98A {Escherichia coli} SCOP: c.94.1.1 PDB: 2abh_A 1a54_A* 1a55_A 1ixi_A 1quk_A 1ixg_A 1oib_A 1pbp_A 1qul_A 1qui_A 1quj_A 1a40_A 2z22_X Back     alignment and structure
Probab=100.00  E-value=0  Score=351.47  Aligned_cols=282  Identities=13%  Similarity=0.098  Sum_probs=226.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             76799980342589999999999987798079998157620578988521013353012133202476787676248787
Q gi|254780707|r   25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD  104 (346)
Q Consensus        25 ~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~~~~~~~  104 (346)
                      +.+|+++|||+++|+|+.|+++|++.|+ +++ +|+++|||+|+++||+|.    +|||++||+|+++|.+.+.      
T Consensus         1 ~~~i~g~GSs~v~p~~~~~a~~f~~~~~-~~v-~~~~~GSg~G~~~~~~G~----~dia~ssr~l~~~e~~~~~------   68 (321)
T 1ixh_A            1 EASLTGAGATFPAPVYAKWADTYQKETG-NKV-NYQGIGSSGGVKQIIANT----VDFGASDAPLSDEKLAQEG------   68 (321)
T ss_dssp             CCEEEEEECSTTHHHHHHHHHHHHHHHC-CEE-EEEECCHHHHHHHHHTTC----SSEEEESSCCCHHHHHHHT------
T ss_pred             CCEEEEECHHHHHHHHHHHHHHHHHHCC-CEE-EEECCCCHHHHHHHHCCC----CCEEECCHHHCHHHHHHCC------
T ss_conf             9508997171799999999999998589-868-997478699999997499----8389828425899997769------


Q ss_pred             CEEEEEECCCCEEEECCCCC---CCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
Q ss_conf             24666521541255416665---456888888876410255555323673023231001112245035448854235789
Q gi|254780707|r  105 IQEVTIGHDGILLVSDRDMV---SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV  181 (346)
Q Consensus       105 ~~~~~v~~d~i~i~~n~~~~---~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~SGT~~~  181 (346)
                      +.+++++.++++++++..++   ..+++.++|.+||.+++..|.+    ....|.++++.+||.||++++|+++|||++.
T Consensus        69 ~~~~~~~~~~~~~~v~~~~~~~~~~~ls~~~l~~If~g~it~W~~----~~~~~~~~~~~~pd~~I~v~~R~~~SGT~~~  144 (321)
T 1ixh_A           69 LFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDD----EAIAKLNPGLKLPSQNIAVVRRADGSGTSFV  144 (321)
T ss_dssp             EEEEEEEEEEEEEEECCTTCCTTCCEECHHHHHHHHTTCCCBTTC----HHHHHHCTTCCCCCCBCEEEEESSCCHHHHH
T ss_pred             CCEEEEEEEEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCC----CCCCCCCCCCCCCCCEEEEEECCCCCCCHHH
T ss_conf             921378876589999546666422311466788987361543457----4100136687788854799707988760688


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHHCCCCC-
Q ss_conf             9988513455565410111110136600013444310246640211662367776310153210013320011001110-
Q gi|254780707|r  182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL-  260 (346)
Q Consensus       182 F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~~~~~~-  260 (346)
                      |+++++...+.+......                 ............+.+..+.+.+..++++|||++++++..+.... 
T Consensus       145 f~~~l~~~~~~~~~~~~~-----------------~~~~~~~~~~~~~~~~~v~~~v~~~~~aiGy~~~~~~~~~~~~~~  207 (321)
T 1ixh_A          145 FTSYLAKVNEEWKNNVGT-----------------GSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYT  207 (321)
T ss_dssp             HHHHHHHHCHHHHHHTCC-----------------CSSCCCSSCEEESHHHHHHHHHHHSTTEEEEEEHHHHHTTTCEEC
T ss_pred             HHHHHHHCCHHHHHCCCC-----------------CCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEEEECHHHCCCCCEE
T ss_conf             999886307344422466-----------------654456753125775376777406877248997414431784036


Q ss_pred             --CCCCCCCCCCCHHHHCC---------------------CCCCCEEEEEEEEECCC--CCCCHHHHHHHHHHHCHHHCC
Q ss_conf             --01344576789556027---------------------98750367899970788--566889999999974987405
Q gi|254780707|r  261 --KLVPIDGIVPSMGTIVS---------------------GLYPISRPLLFYVKRQH--FNSVLGLREYVSFSVSDEMMA  315 (346)
Q Consensus       261 --~~~~~~~v~p~~~~i~~---------------------g~YPl~r~ly~yv~~~~--~~~~~~~~~Fl~~~ls~~~~~  315 (346)
                        .....+++.|+.+++.+                     |+|||+|+||+|++++.  .+..+.+++||+|++|+ +|+
T Consensus       208 ~i~~~~~~~v~Pt~~~i~~~~~~~~~~~~~~~~~~~~~~~g~YPi~r~ly~~v~~~~~~~~~~~~v~~Fl~~~ls~-gq~  286 (321)
T 1ixh_A          208 KLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKT-GAK  286 (321)
T ss_dssp             EEECTTSCEECCCHHHHHHHTTTCCTTTCSCCCCBSCCSTTCCSBEEEEEEEEESBCSSHHHHHHHHHHHHHHHHH-CHH
T ss_pred             EEECCCCCEECCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHH-HHH
T ss_conf             7762789721677778754311345466643114678888962010168999976789867789999999999872-778


Q ss_pred             CCCHHHHCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             2202775596348999999999999607
Q gi|254780707|r  316 PDSQLFQYGLIPISNEERKSVRDSIAVG  343 (346)
Q Consensus       316 ~~~~~~~~GyvPLp~~~~~~~~~~~~~~  343 (346)
                         ++.++||+|||+++++++++++++.
T Consensus       287 ---~~~~~GyvPLp~~~~~~~~~~~~~~  311 (321)
T 1ixh_A          287 ---QANDLDYASLPDSVVEQVRAAWKTN  311 (321)
T ss_dssp             ---HHHHTTCEECCHHHHHHHHHHHHHH
T ss_pred             ---HHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             ---8987898009999999999999974



>3g63_A Pfluding; subatomic resolution, phosphate binding, DING protein, hydrogen ATOM, phosphate binding protein; 0.88A {Pseudomonas fluorescens SBW25} PDB: 3g62_A 2q9t_A 2v3q_A 2cap_A Back     alignment and structure
>1twy_A ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} SCOP: c.94.1.1 Back     alignment and structure
>3cvg_A Putative metal binding protein; PSI-II, NYSGXRC, periplasmic, structural genomics, protein structure initiative; 1.97A {Coccidioides immitis RS} Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>1amf_A Molybdate transport protein MODA; periplasmic, binding protein; 1.75A {Escherichia coli} SCOP: c.94.1.1 PDB: 1wod_A Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens} Back     alignment and structure
>3kn3_A Putative periplasmic protein; alpha-beta structure, periplasmic binding protein fold, structural genomics, PSI-2; HET: GTT CIT; 2.41A {Wolinella succinogenes} Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Back     alignment and structure
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmic binding protein; polyamine binding, syphilis, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>1i6a_A OXYR, hydrogen peroxide-inducible genes activator; OXYR regulatory domain, oxidized form, transcription; 2.30A {Escherichia coli} SCOP: c.94.1.1 PDB: 1i69_A Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter substrate-binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Back     alignment and structure
>3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, protein structure initiative; 2.71A {Pseudomonas aeruginosa PA01} Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Back     alignment and structure
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Methanosarcina acetivorans} Back     alignment and structure
>3k6v_A Solute-binding protein MA_0280; MODA, molybdate, periplasmic binding protein, ABC transporter, transport protein, ligand; HET: CIT; 1.69A {Methanosarcina acetivorans} PDB: 3k6u_A* 3k6w_A 3k6x_A Back     alignment and structure
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 1qvs_A 2o6a_A 2o68_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, periplasmic binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Back     alignment and structure
>2hzl_A Trap-T family sorbitol/mannitol transporter, periplasmic binding protein, SMOM; trap transporter, periplasmic subunit, ligand binding; 1.40A {Rhodobacter sphaeroides 2} PDB: 2hzk_A Back     alignment and structure
>2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding domain, cysteine biosynthesis; 2.80A {Escherichia coli K12} SCOP: c.94.1.1 Back     alignment and structure
>2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR structural genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli K12} PDB: 3hfu_A Back     alignment and structure
>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domains, DNA binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A Back     alignment and structure
>2h9b_A HTH-type transcriptional regulator BENM; LTTR, transcriptional activator, LYSR-type transcriptional regulator; 1.80A {Acinetobacter SP} PDB: 2h99_A 3k1m_A 3k1n_A 3k1p_A 2f7a_A* 2f6p_A 2f78_A 2f6g_A* 2f8d_A 2f97_A* Back     alignment and structure
>1al3_A Cys regulon transcriptional activator CYSB; LYSR family, cysteine biosynthesis, transcription regulation; 1.80A {Klebsiella aerogenes} SCOP: c.94.1.1 Back     alignment and structure
>2ql3_A Probable transcriptional regulator, LYSR family protein; APC7314, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Rhodococcus SP} Back     alignment and structure
>2h98_A HTH-type transcriptional regulator CATM; BENM, LTTR; 1.80A {Acinetobacter SP} PDB: 2h9q_A* 2f7b_A 2f7c_A* 3glb_A* Back     alignment and structure
>3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- plasmid, transcription, transcription regulation; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} PDB: 1y4t_A Back     alignment and structure
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1 Back     alignment and structure
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A* Back     alignment and structure
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Back     alignment and structure
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 346 putative phosphate-binding periplasmic protein [Candida
d1pc3a_333 c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium 6e-25
d1ixha_321 c.94.1.1 (A:) Phosphate-binding protein {Escherichia co 1e-21
d2v3qa1376 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein 1e-21
d1twya_249 c.94.1.1 (A:) ABC transporter, periplasmic substrate-bi 6e-21
>d1pc3a_ c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 333 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Phosphate-binding protein
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  108 bits (270), Expect = 6e-25
 Identities = 46/340 (13%), Positives = 100/340 (29%), Gaps = 32/340 (9%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   +   +   GS+ L+P   +    F E +P   T   +  GS  G+ +   G    T
Sbjct: 4   TPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNV-TITAQGTGSGAGIAQAAAG----T 58

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           ++I  S   +++ ++   K      +  + +      +  +   VS  L +     A   
Sbjct: 59  VNIGASDAYLSEGDMAAHK-----GLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMY 113

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                 K   +P         + P   +     S   G   +  + + ++          
Sbjct: 114 Q--GTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPG 171

Query: 200 MRDMFKYNVQQLSV-------ACTSVRQDGIAIEVDGDYTETLARIEVNKDV-FGFVGLS 251
                 +     ++         T   +    +   G      A      +   G    +
Sbjct: 172 FGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGN 231

Query: 252 FYKNNADVLKLV--------PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG--L 301
           F   +A  ++          P +  +  +       YPI       V  +  ++     L
Sbjct: 232 FLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTL 291

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           + ++ ++++D      S L Q    P+     K     IA
Sbjct: 292 QAFLHWAITDG--NKASFLDQVHFQPLPPAVVKLSDALIA 329


>d1ixha_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]} Length = 321 Back     information, alignment and structure
>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 376 Back     information, alignment and structure
>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]} Length = 249 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target346 putative phosphate-binding periplasmic protein [Candida
d1pc3a_333 Phosphate-binding protein {Mycobacterium tuberculosis [ 100.0
d1ixha_321 Phosphate-binding protein {Escherichia coli [TaxId: 562 100.0
d2v3qa1376 PstS-like phosphate-binding protein {Human (Homo sapien 100.0
d1twya_249 ABC transporter, periplasmic substrate-binding protein 100.0
d1atga_231 Molybdate-binding protein, ModA {Azotobacter vinelandii 99.38
d1amfa_231 Molybdate-binding protein, ModA {Escherichia coli [TaxI 99.29
d1sbpa_309 Sulphate-binding protein {Salmonella typhimurium [TaxId 98.81
d2onsa1311 Molybdate-binding protein, ModA {Archaeoglobus fulgidus 98.6
d1nnfa_308 Ferric-binding protein FbpA {Haemophilus influenzae [Ta 97.85
d1y9ua_318 Ferric-binding protein FbpA {Bordetella pertussis [TaxI 96.25
d1us5a_298 Putative GluR0 ligand binding core {Thermus thermophilu 96.04
d1xvxa_311 Ferric-binding protein FbpA {Yersinia enterocolitica, Y 98.08
d1pota_322 Spermidine/putrescine-binding protein PotD {Escherichia 97.43
d1q35a_318 Ferric-binding protein FbpA {Mannheimia haemolytica [Ta 96.66
d1i6aa_212 Hydrogen peroxide-inducible genes LysR-type activator O 96.65
d1eu8a_407 D-maltodextrin-binding protein, MBP {Archaeon Thermococ 96.43
d1elja_380 D-maltodextrin-binding protein, MBP {Archaeon Pyrococcu 96.26
d2esna2212 Probable LysR-type transcriptional regulator PA0477 {Ps 95.0
d1utha_219 LysR-type regulatory protein DntR {Burkholderia sp. [Ta 92.74
d2fyia1220 LysR-type regulatory protein Cbl {Escherichia coli [Tax 97.99
d1ixca2205 LysR-type regulatory protein CbnR {Ralstonia eutropha [ 97.6
d1al3a_237 Cofactor-binding fragment of LysR-type protein CysB {Kl 97.55
d1y4ta_317 Ferric-binding protein FbpA {Campylobacter jejuni [TaxI 97.41
d3thia_362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 492 96.16
d1a99a_341 Putrescine receptor (PotF) {Escherichia coli [TaxId: 56 94.57
d1ursa_367 D-maltodextrin-binding protein, MBP {Alicyclobacillus a 94.57
>d1pc3a_ c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Phosphate-binding protein
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00  E-value=0  Score=361.83  Aligned_cols=296  Identities=15%  Similarity=0.160  Sum_probs=228.3

Q ss_pred             CCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHH
Q ss_conf             14201376799980342589999999999987798079998157620578988521013353012133202476787676
Q gi|254780707|r   19 GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECK   98 (346)
Q Consensus        19 ~~~~~a~~~I~i~GSst~~P~~~~~a~~y~~~~~~~~~~~~~~~GSg~Gi~~~~~G~~~~~~dig~ssr~l~~~E~~~~~   98 (346)
                      .+++.+..+|+++|||+++|+++.|+++|++.||++++ +|+++|||+|+++||+|.    +|||++||+|+++|++.|.
T Consensus         3 ~~~~~~~~~l~~~GSst~~p~~~~~a~~y~~~~~~~~v-~~~~~GSg~G~~~~~~g~----~di~~ssr~l~~~E~~~~~   77 (333)
T d1pc3a_           3 TTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTI-TAQGTGSGAGIAQAAAGT----VNIGASDAYLSEGDMAAHK   77 (333)
T ss_dssp             CSCCSSCEEEEEEECTTTHHHHHHHHHHHHHHSTTEEE-ECCBCCHHHHHHHHHTTS----CSEEEESSCCCHHHHHHST
T ss_pred             CCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCEEE-EEECCCCHHHHHHHHCCC----CCEEEECHHHHHHHHHHHC
T ss_conf             67778885699975366999999999999988889069-996267689999997599----9389857777667875403


Q ss_pred             HCCCCCCEEEEEECCCCEEEECCCC--CCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCCC
Q ss_conf             2487872466652154125541666--54568888888764102555553236730232310011122450354488542
Q gi|254780707|r   99 KHGVSDIQEVTIGHDGILLVSDRDM--VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH  176 (346)
Q Consensus        99 ~~~~~~~~~~~v~~d~i~i~~n~~~--~~~~lt~~~l~~~~~~~~~~~~~i~~g~i~~W~~~~~~lp~~~I~~~~r~~~S  176 (346)
                           .+.++++++|++++++|.++  +..+|+.+++.+||.+++..|.    .....|.+++..+|+.+|++++|+++|
T Consensus        78 -----~~~~~~v~~~~i~v~v~~~~~~~~~~Lt~~~l~~i~~G~itnW~----~~~~~~~n~~~~~p~~~I~v~~r~~~S  148 (333)
T d1pc3a_          78 -----GLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWD----DPQIAALNPGVNLPGTAVVPLHRSDGS  148 (333)
T ss_dssp             -----TEEEEEEEEEEEEEEECCTTCCSCCEECHHHHHHHHHTSCCBTT----CHHHHHHSTTCCCCCCBCEECEESSCC
T ss_pred             -----CEEEEEEEEEEEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCC----CCCCCCCCCCCCCCCCCEEEECCCCCC
T ss_conf             -----23530279850244454013553101289998675478755246----533333356777898613873178776


Q ss_pred             CHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHCCCCCCCCCCC-CCCEECCCCHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             357899988513455565410111110136600013444310246-6402116623677763101532100133200110
Q gi|254780707|r  177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD-GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN  255 (346)
Q Consensus       177 GT~~~F~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~i~~~~~~~~~~~~v~~~~~~igy~~~~~~~~  255 (346)
                      ||++.|+++++...+..+.......              ...... .......+.+..+.+.+..++++|||++++|+..
T Consensus       149 GT~~~f~~~l~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~v~~~v~~~~~aIGy~~~~~~~~  214 (333)
T d1pc3a_         149 GDTFLFTQYLSKQDPEGWGKSPGFG--------------TTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQ  214 (333)
T ss_dssp             HHHHHHHHHHHHHCTTTTTTTTCCS--------------SSCCCCCCTTCCEECHHHHHHHHHHHSTTEEEEEEGGGHHH
T ss_pred             CCHHHHHHHHHHCCCCCHHHCCCCC--------------CCCCCCCCCCCEECCCCHHHHHHHHCCCCCCCCCCEEEHHH
T ss_conf             3046668876511741022124766--------------43134556650331575899988745832102452130222


Q ss_pred             CCC-CC-----CCCCCCCCCCCHHHHC-----------------------CCCCCCEEEEEEEEECCCCC--CCHHHHHH
Q ss_conf             011-10-----0134457678955602-----------------------79875036789997078856--68899999
Q gi|254780707|r  256 NAD-VL-----KLVPIDGIVPSMGTIV-----------------------SGLYPISRPLLFYVKRQHFN--SVLGLREY  304 (346)
Q Consensus       256 ~~~-~~-----~~~~~~~v~p~~~~i~-----------------------~g~YPl~r~ly~yv~~~~~~--~~~~~~~F  304 (346)
                      +.. .+     .....+.+.|+.+++.                       +|+|||+|++|+|+++++.+  ..+.+++|
T Consensus       215 ~~~~~~~~a~~~~~~g~~v~Pt~~~i~~~~~~~~~~~~~~~~~~~~~~~~~g~YPi~~~~y~~v~~~~~~~~~~~~v~~F  294 (333)
T d1pc3a_         215 ASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAF  294 (333)
T ss_dssp             HHHTTCEECEEECTTSCEECCSHHHHHHHHTTTTTCCCTTCCCCCTTCSCTTCCSCEEEEEEEEESBCSSHHHHHHHHHH
T ss_pred             CCCCCHHHEEEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCEEECCCCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHH
T ss_conf             01222121121013466668856665443202333457874132045777896541107999995578973545999999


Q ss_pred             HHHHHCHHHCCCCCHHHHCCCCCCCHHHHHHHHHHHHCCC
Q ss_conf             9997498740522027755963489999999999996077
Q gi|254780707|r  305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK  344 (346)
Q Consensus       305 l~~~ls~~~~~~~~~~~~~GyvPLp~~~~~~~~~~~~~~~  344 (346)
                      ++|+||+++|  +.+++++||||||++++++++++++...
T Consensus       295 l~~~ls~~gq--~~~~~~~GyvPLp~~~~~~~~~~~~~i~  332 (333)
T d1pc3a_         295 LHWAITDGNK--ASFLDQVHFQPLPPAVVKLSDALIATIS  332 (333)
T ss_dssp             HHHHTTGGGS--HHHHHHHTCBCCCHHHHHHHHHHHTTCB
T ss_pred             HHHHHCCCCH--HHHHHHCCCEECCHHHHHHHHHHHHHHC
T ss_conf             9998584147--7778858985799999999999998614



>d1ixha_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1us5a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
>d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure