254780721

254780721

pilus component protein

GeneID in NCBI database:8209726Locus tag:CLIBASIA_03040
Protein GI in NCBI database:254780721Protein Accession:YP_003065134.1
Gene range:+(545277, 546266)Protein Length:329aa
Gene description:pilus component protein
COG prediction:[N] [U] Flp pilus assembly protein TadC
KEGG prediction:pilus component protein; K12511 tight adherence protein C
SEED prediction:Type II/IV secretion system protein TadC, associated with Flp pilus assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM4 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH
cHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mphyffdlfdaTELAVAITTAVSIFSLIYAVvipslgsgelEKRMKSVAVEREILRKQQITSLQKdsassrlrtrdsKSLRNFVKKLNLKAILVDENIVNKLRaagfrseySLNILLVVRLVVPIIFLILGIIWIFGYdklleypfqLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAediggqsvplsEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALiqsdrygtsigDSLRVLVSETRSERLMEAEKKAAslgpkltvpmiIFFLPVLILVIIGPAILSIIDTMKDH
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIpslgsgelEKRMKSVAVEREIlrkqqitslqkdsassrlrtrdskslrnfvkklnlkailvdenIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQAliqsdrygtsigdslrVLVSETRSERLMEAEKkaaslgpkltvPMIIFFLPVLILVIIGPAILSIIDTMKDH
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSlnillvvrlvvpiiflilgiiwifgYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMiifflpvlilviigpailSIIDTMKDH
**HYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGE************************************************************KLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSE**********SLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK**
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQ*****************SKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMK**
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooo
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooo
SSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH
MPHYFFDLFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIFLILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFLPVLILVIIGPAILSIIDTMKDH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target329 pilus component protein [Candidatus Liberibacter asiati
254780163798 ATP-dependent Clp protease ATP-binding subunit [Ca 0.005
254780722187 pilus assembly protein [Candidatus Liberibacter as 0.043
>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment
 Score = 33.5 bits (75), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 157 GYVGFCAPSVWISNLVQKRQS-----SIKRAWPDALDLLLICVESGISIDQALRRVA 208
           GYVGF    +   ++ Q   S      I+++ PD L++LL  ++ GI  DQ+ ++++
Sbjct: 558 GYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKIS 614

>gi|254780722|ref|YP_003065135.1| pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 187 Back     alignment
 Score = 30.4 bits (67), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 55/110 (50%), Gaps = 17/110 (15%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL--------- 218
           + +L++KR +     +P+ALD+++  V +G+ +  A   VA  +G  S P+         
Sbjct: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57

Query: 219 SEEMLLTIAE-----LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263
           ++ + L+++E     + ++P ++V+F +     Q     N ++AL    R
Sbjct: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSR 107

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target329 pilus component protein [Candidatus Liberibacter asiati
315121886319 pilus component protein [Candidatus Liberibacter solana 1 1e-137
327194689328 pilus component protein [Rhizobium etli CNPAF512] Lengt 1 7e-94
190889886328 pilus component protein [Rhizobium etli CIAT 652] Lengt 1 1e-93
209551764328 type II secretion system protein [Rhizobium leguminosar 1 2e-93
241207162328 type II secretion system protein [Rhizobium leguminosar 1 3e-93
15887568328 components of type IV pilus [Agrobacterium tumefaciens 1 1e-92
222084474325 pilus assembly protein [Agrobacterium radiobacter K84] 1 2e-92
116249986328 component of pilus protein [Rhizobium leguminosarum bv. 1 6e-92
325291654328 components of type IV pilus [Agrobacterium sp. H13-3] L 1 3e-91
86355869328 pilus assembly protein [Rhizobium etli CFN 42] Length = 1 4e-91
>gi|315121886|ref|YP_004062375.1| pilus component protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 319 Back     alignment and organism information
 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 242/320 (75%), Positives = 284/320 (88%), Gaps = 2/320 (0%)

Query: 8   LFDATELAVAITTAVSIFSLIYAVVIPSLGSGELEKRMKSVAVEREILRKQQITSLQKDS 67
           +FD+  +AV + T++S+FSLIYAV+IPSLGS ELEKR+KSV++ERE LRKQQ+  L K  
Sbjct: 1   MFDSVTIAVVVATSISVFSLIYAVIIPSLGSDELEKRIKSVSIEREELRKQQLARLGK-- 58

Query: 68  ASSRLRTRDSKSLRNFVKKLNLKAILVDENIVNKLRAAGFRSEYSLNILLVVRLVVPIIF 127
            SS LRT D+ SLR FV+K NLKAILVD+ +V+KLRAAGFRSEY+LNILL++RLV+PII 
Sbjct: 59  PSSGLRTHDNMSLRKFVEKFNLKAILVDKPMVDKLRAAGFRSEYALNILLIIRLVLPIIT 118

Query: 128 LILGIIWIFGYDKLLEYPFQLRVGAVILIGYVGFCAPSVWISNLVQKRQSSIKRAWPDAL 187
           L++GIIWIFG+DKL +Y F  R+  VILIGY GF APS++ISNLV KRQ SI+RAWPDAL
Sbjct: 119 LVIGIIWIFGFDKLEQYSFFNRLFVVILIGYAGFYAPSMFISNLVTKRQDSIRRAWPDAL 178

Query: 188 DLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQ 247
           DLLLIC+ESGI++DQALRRVAE++GGQSV LSEE+LLT AELSFL NRQVAFENFYNRTQ
Sbjct: 179 DLLLICIESGIAVDQALRRVAEEVGGQSVALSEELLLTTAELSFLLNRQVAFENFYNRTQ 238

Query: 248 MDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASLGPKLTVPMIIFFL 307
           MDC+RN  QA IQSDRYGTSIGDSLRVLV+ETRSERLMEAEKKAA+L PKLTVPMI+FFL
Sbjct: 239 MDCIRNVMQAFIQSDRYGTSIGDSLRVLVAETRSERLMEAEKKAAALSPKLTVPMILFFL 298

Query: 308 PVLILVIIGPAILSIIDTMK 327
           PVL+LVIIGPAIL+I+DTMK
Sbjct: 299 PVLMLVIIGPAILNIMDTMK 318


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327194689|gb|EGE61535.1| pilus component protein [Rhizobium etli CNPAF512] Length = 328 Back     alignment and organism information
>gi|190889886|ref|YP_001976428.1| pilus component protein [Rhizobium etli CIAT 652] Length = 328 Back     alignment and organism information
>gi|209551764|ref|YP_002283681.1| type II secretion system protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 328 Back     alignment and organism information
>gi|241207162|ref|YP_002978258.1| type II secretion system protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 328 Back     alignment and organism information
>gi|15887568|ref|NP_353249.1| components of type IV pilus [Agrobacterium tumefaciens str. C58] Length = 328 Back     alignment and organism information
>gi|222084474|ref|YP_002543003.1| pilus assembly protein [Agrobacterium radiobacter K84] Length = 325 Back     alignment and organism information
>gi|116249986|ref|YP_765824.1| component of pilus protein [Rhizobium leguminosarum bv. viciae 3841] Length = 328 Back     alignment and organism information
>gi|325291654|ref|YP_004277518.1| components of type IV pilus [Agrobacterium sp. H13-3] Length = 328 Back     alignment and organism information
>gi|86355869|ref|YP_467761.1| pilus assembly protein [Rhizobium etli CFN 42] Length = 328 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target329 pilus component protein [Candidatus Liberibacter asiati
pfam00482125 pfam00482, GSPII_F, Bacterial type II secretion system 1e-10
COG4965309 COG4965, TadB, Flp pilus assembly protein TadB [Intrace 4e-08
COG2064320 COG2064, TadC, Flp pilus assembly protein TadC [Cell mo 2e-26
>gnl|CDD|144175 pfam00482, GSPII_F, Bacterial type II secretion system protein F domain Back     alignment and domain information
>gnl|CDD|34572 COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|32247 COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 329 pilus component protein [Candidatus Liberibacter asiati
COG4965309 TadB Flp pilus assembly protein TadB [Intracellular tra 100.0
PRK06041 547 flagellar assembly protein J; Reviewed 99.49
COG1955 527 FlaJ Archaeal flagella assembly protein J [Cell motilit 98.87
TIGR02120414 GspF general secretion pathway protein F; InterPro: IPR 98.82
TIGR02120 414 GspF general secretion pathway protein F; InterPro: IPR 98.47
TIGR02833170 spore_III_AB stage III sporulation protein AB; InterPro 93.83
COG2064320 TadC Flp pilus assembly protein TadC [Cell motility and 99.95
PRK06041547 flagellar assembly protein J; Reviewed 99.64
COG1955527 FlaJ Archaeal flagella assembly protein J [Cell motilit 99.12
COG1459397 PulF Type II secretory pathway, component PulF [Cell mo 99.07
pfam00482125 GSPII_F Bacterial type II secretion system protein F do 99.39
PRK10573397 type IV pilin biogenesis protein; Provisional 99.2
PRK10573397 type IV pilin biogenesis protein; Provisional 99.2
COG1459397 PulF Type II secretory pathway, component PulF [Cell mo 98.85
pfam09548170 Spore_III_AB Stage III sporulation protein AB (spore_II 96.7
PRK08307172 stage III sporulation protein SpoAB; Provisional 95.67
>COG4965 TadB Flp pilus assembly protein TadB [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06041 flagellar assembly protein J; Reviewed Back     alignment and domain information
>COG1955 FlaJ Archaeal flagella assembly protein J [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02120 GspF general secretion pathway protein F; InterPro: IPR011850 This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the "Type II" secretion pathway Back     alignment and domain information
>TIGR02120 GspF general secretion pathway protein F; InterPro: IPR011850 This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the "Type II" secretion pathway Back     alignment and domain information
>TIGR02833 spore_III_AB stage III sporulation protein AB; InterPro: IPR014198 This entry represents the stage III sporulation protein AB, which is encoded in a spore formation operon: spoIIIAABCDEFGH that is under sigma G regulation Back     alignment and domain information
>COG2064 TadC Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06041 flagellar assembly protein J; Reviewed Back     alignment and domain information
>COG1955 FlaJ Archaeal flagella assembly protein J [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1459 PulF Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam00482 GSPII_F Bacterial type II secretion system protein F domain Back     alignment and domain information
>PRK10573 type IV pilin biogenesis protein; Provisional Back     alignment and domain information
>PRK10573 type IV pilin biogenesis protein; Provisional Back     alignment and domain information
>COG1459 PulF Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam09548 Spore_III_AB Stage III sporulation protein AB (spore_III_AB) Back     alignment and domain information
>PRK08307 stage III sporulation protein SpoAB; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target329 pilus component protein [Candidatus Liberibacter asiati
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.003
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 38.1 bits (87), Expect = 0.003
 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 14/43 (32%)

Query: 51 EREILRKQQITSLQKDSASSRLRTRDSKSLRNFVKKLNLKAIL 93
          E++ L+K     LQ   AS +L   DS         L +KA +
Sbjct: 18 EKQALKK-----LQ---ASLKLYADDS------APALAIKATM 46


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target329 pilus component protein [Candidatus Liberibacter asiati
3c1q_A123 General secretion pathway protein F; type 2 secretion s 98.65
2whn_A116 PILC, pilus assembly protein PILC; transport, transmemb 98.45
>3c1q_A General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* Back     alignment and structure
Probab=98.65  E-value=7.2e-07  Score=62.12  Aligned_cols=106  Identities=14%  Similarity=0.165  Sum_probs=85.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             99999999999999749968999999998407787789999999999996599989999999986399589999999999
Q gi|254780721|r  181 RAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALIQ  260 (329)
Q Consensus       181 ~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~~~~~l~~  260 (329)
                      .++..|...++..+++|+|+.+|++.+++..  .++.+++.+..+..+++.|.++.+|+.......|     .+...++.
T Consensus        12 ~~l~~f~~~La~Ll~sGv~l~~aL~~~~~~~--~~~~~~~~~~~i~~~l~~G~~ls~Al~~~~~~f~-----~~~i~mi~   84 (123)
T 3c1q_A           12 PDLALITRQLATLVQSGMPLEECLRAVAEQS--EKPRIRTMLVAVRAKVTEGYTLSDSLGDYPHVFD-----ELFRSMVA   84 (123)
T ss_dssp             HHHHHHHHHHHHHHHTTCCHHHHHHHHHHTC--SCHHHHHHHHHHHHHHHTTCCHHHHHTTCTTTSC-----HHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCC-----HHHHHHHH
T ss_conf             9999999999999986998999999997144--1289999999999999845539999987545586-----99999999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997199589999999999999999999999984
Q gi|254780721|r  261 SDRYGTSIGDSLRVLVSETRSERLMEAEKKAAS  293 (329)
Q Consensus       261 ~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~  293 (329)
                      +-+.+|++.++|+.+++..+++...+.+.+..+
T Consensus        85 ~GE~sG~L~~~l~~la~~~e~~~~~~~kik~A~  117 (123)
T 3c1q_A           85 AGEKSGHLDSVLERLADYAENRQKMRSKLQQAS  117 (123)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             998747799999999999999999999999999



>2whn_A PILC, pilus assembly protein PILC; transport, transmembrane, pilus biogenesis, protein transport; 2.05A {Thermus thermophilus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 329 pilus component protein [Candidatus Liberibacter a
3c1q_A_123 (A:) General secretion pathway protein F; type 2 s 7e-06
>3c1q_A (A:) General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A*Length = 123 Back     alignment and structure
 Score = 46.0 bits (109), Expect = 7e-06
 Identities = 15/129 (11%), Positives = 41/129 (31%), Gaps = 9/129 (6%)

Query: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIA 227
           +    ++  S            L   V+SG  +++ LR VAE        +   ++   A
Sbjct: 1   MGFAFKRGIS--TPDLALITRQLATLVQSGXPLEECLRAVAEQSE--KPRIRTXLVAVRA 56

Query: 228 ELSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDRYGTSIGDSLRVLVSETRSERLMEA 287
           +++       +  ++ +            + + +      +   L  L     + +   +
Sbjct: 57  KVTEGYTLSDSLGDYPHVFDELFR-----SXVAAGEKSGHLDSVLERLADYAENRQKXRS 111

Query: 288 EKKAASLGP 296
           + + AS   
Sbjct: 112 KLQQASENL 120


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target329 pilus component protein [Candidatus Liberibacter asiati
3c1q_A_123 General secretion pathway protein F; type 2 secret 99.26
3c1q_A_123 General secretion pathway protein F; type 2 secret 93.9
>3c1q_A (A:) General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* Back     alignment and structure
Probab=99.26  E-value=1.2e-10  Score=88.04  Aligned_cols=108  Identities=13%  Similarity=0.137  Sum_probs=95.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             99999999999999974996899999999840778778999999999999659998999999998639958999999999
Q gi|254780721|r  180 KRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPLSEEMLLTIAELSFLPNRQVAFENFYNRTQMDCVRNATQALI  259 (329)
Q Consensus       180 ~~~lP~~ld~l~~~~~aG~~l~~Al~~va~e~~~~~~~l~~e~~~~~~~~~~G~~~~~Al~~~a~r~~~~~~~~~~~~l~  259 (329)
                      ..++|++++.++.++++|+|+.+|+..++++  ..++++++++..+.++++.|.++.+||.+++.+++     .++..++
T Consensus        11 ~~~~~~f~~~l~~ll~~G~~l~~al~~~~~~--~~~~~l~~~~~~i~~~l~~G~~~~~Al~~~~~~~~-----~~~~~~i   83 (123)
T 3c1q_A           11 TPDLALITRQLATLVQSGXPLEECLRAVAEQ--SEKPRIRTXLVAVRAKVTEGYTLSDSLGDYPHVFD-----ELFRSXV   83 (123)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHHT--CSCHHHHHHHHHHHHHHHTTCCHHHHHTTCTTTSC-----HHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH--CCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCC-----HHHHHHH
T ss_conf             9999999999999998699899999999714--41289999999999999845539999987545586-----9999999


Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99971995899999999999999999999999843
Q gi|254780721|r  260 QSDRYGTSIGDSLRVLVSETRSERLMEAEKKAASL  294 (329)
Q Consensus       260 ~~~~~G~~l~~~L~~~a~~~r~~~~~~~e~~a~~~  294 (329)
                      .+.+.||+++++|+..++.++++...+.+.+....
T Consensus        84 ~~ge~~G~L~~~l~~~a~~~~~~~~~~~~~~~~l~  118 (123)
T 3c1q_A           84 AAGEKSGHLDSVLERLADYAENRQKXRSKLQQASE  118 (123)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHTTC-
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99987477999999999999999999999999999



>3c1q_A (A:) General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* Back     alignment and structure