254780722

254780722

pilus assembly protein

GeneID in NCBI database:8209727Locus tag:CLIBASIA_03045
Protein GI in NCBI database:254780722Protein Accession:YP_003065135.1
Gene range:+(544698, 545261)Protein Length:187aa
Gene description:pilus assembly protein
COG prediction:[U] Flp pilus assembly protein TadB
KEGG prediction:pilus assembly protein; K12510 tight adherence protein B
SEED prediction:Flp pilus assembly protein TadB
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHEEEEHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccc
MKHLIKKRTAkflddfpnALDIIVRSVraglpvsdAVAVIVgqssdpvrSEFRRVIETQHLGLSLSESISRMVrymplqevsFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVyftspgymnvlindprghmLLGVAAAFMLIGIMVMRLMINFDV
mkhlikkrtakflddfpnALDIIVRSVRAGLPVSDAVAVIVgqssdpvrsEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
******KRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKN********SMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV
MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMRLMINFDV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target187 pilus assembly protein [Candidatus Liberibacter asiatic
254780721329 pilus component protein [Candidatus Liberibacter a 0.020
254780594230 Glutathione S-transferase domain protein [Candidat 0.048
>gi|254780721|ref|YP_003065134.1| pilus component protein [Candidatus Liberibacter asiaticus str. psy62] Length = 329 Back     alignment
 Score = 30.4 bits (67), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 55/110 (50%), Gaps = 17/110 (15%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDA---VAVIVGQSSDPVRSEFRRVIE 57
           + +L++KR +     +P+ALD+++  V +G+ +  A   VA  +G  S P+         
Sbjct: 168 ISNLVQKRQSSIKRAWPDALDLLLICVESGISIDQALRRVAEDIGGQSVPL--------- 218

Query: 58  TQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSR 107
           ++ + L+++E     + ++P ++V+F +     Q     N ++AL    R
Sbjct: 219 SEEMLLTIAE-----LSFLPNRQVAFENFYNRTQMDCVRNATQALIQSDR 263

>gi|254780594|ref|YP_003065007.1| Glutathione S-transferase domain protein [Candidatus Liberibacter asiaticus str. psy62] Length = 230 Back     alignment
 Score = 29.3 bits (64), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 16/93 (17%)

Query: 44  SSDPV-RSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEAL 102
           S+DP+ R+E RR+IE       + + ++R     PL     +   ++ + Q GG+     
Sbjct: 86  STDPLQRAETRRMIEW--FMYQMEQDVTR-----PLAHERVYKLHMTTE-QGGGSPD--- 134

Query: 103 ANLSRILR-DRKNMKAKVQALSMEAKASAWIIG 134
              S++LR  R NM+  ++ ++   K+ +WI G
Sbjct: 135 ---SKVLRIARNNMREHIKYITWLIKSRSWIAG 164

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target187 pilus assembly protein [Candidatus Liberibacter asiatic
315121887328 pilus assembly protein [Candidatus Liberibacter solanac 1 1e-81
86355868335 pilus assembly protein [Rhizobium etli CFN 42] Length = 1 5e-66
209551763335 type II secretion system protein [Rhizobium leguminosar 1 1e-65
241207161335 type II secretion system protein [Rhizobium leguminosar 1 3e-65
116249985335 pilus assembly protein [Rhizobium leguminosarum bv. vic 1 3e-65
190889885335 pilus assembly protein [Rhizobium etli CIAT 652] Length 1 5e-65
218516696335 probable pilus assembly protein [Rhizobium etli 8C-3] L 1 6e-65
218461009335 probable pilus assembly protein [Rhizobium etli Kim 5] 1 1e-64
150398545336 type II secretion system protein [Sinorhizobium medicae 1 2e-64
227823975336 putative type II/IV secretion system protein TadB, Flp 1 3e-64
>gi|315121887|ref|YP_004062376.1| pilus assembly protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 328 Back     alignment and organism information
 Score =  306 bits (783), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 173/186 (93%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIETQH 60
           +++LIKKRTAKFL++FPNALDIIVRSVR+GLPVSDA+++IVGQSSDPVRSEFRRV+E QH
Sbjct: 142 LQYLIKKRTAKFLNEFPNALDIIVRSVRSGLPVSDAISIIVGQSSDPVRSEFRRVVEAQH 201

Query: 61  LGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQ 120
           LGLS+SES++RMVRYMPLQEVSFFSTVIS+Q+Q GGNLSEAL+NLS ILR+RK MK KVQ
Sbjct: 202 LGLSVSESVARMVRYMPLQEVSFFSTVISIQAQSGGNLSEALSNLSGILRERKKMKGKVQ 261

Query: 121 ALSMEAKASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLIGIMVMR 180
           AL+MEAK+SAWIIGSLPF VS+LV+FTSPGY+++L  D RGH++LG+AA  M++G ++MR
Sbjct: 262 ALAMEAKSSAWIIGSLPFFVSSLVHFTSPGYIDILFLDSRGHIILGIAAFLMVLGAVIMR 321

Query: 181 LMINFD 186
            MINFD
Sbjct: 322 TMINFD 327


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86355868|ref|YP_467760.1| pilus assembly protein [Rhizobium etli CFN 42] Length = 335 Back     alignment and organism information
>gi|209551763|ref|YP_002283680.1| type II secretion system protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 335 Back     alignment and organism information
>gi|241207161|ref|YP_002978257.1| type II secretion system protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 335 Back     alignment and organism information
>gi|116249985|ref|YP_765823.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841] Length = 335 Back     alignment and organism information
>gi|190889885|ref|YP_001976427.1| pilus assembly protein [Rhizobium etli CIAT 652] Length = 335 Back     alignment and organism information
>gi|218516696|ref|ZP_03513536.1| probable pilus assembly protein [Rhizobium etli 8C-3] Length = 335 Back     alignment and organism information
>gi|218461009|ref|ZP_03501100.1| probable pilus assembly protein [Rhizobium etli Kim 5] Length = 335 Back     alignment and organism information
>gi|150398545|ref|YP_001329012.1| type II secretion system protein [Sinorhizobium medicae WSM419] Length = 336 Back     alignment and organism information
>gi|227823975|ref|YP_002827948.1| putative type II/IV secretion system protein TadB, Flp pilus assembly protein TadB [Sinorhizobium fredii NGR234] Length = 336 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target187 pilus assembly protein [Candidatus Liberibacter asiatic
pfam00482125 pfam00482, GSPII_F, Bacterial type II secretion system 4e-10
COG2064320 COG2064, TadC, Flp pilus assembly protein TadC [Cell mo 2e-04
COG1459 397 COG1459, PulF, Type II secretory pathway, component Pul 0.004
COG4965309 COG4965, TadB, Flp pilus assembly protein TadB [Intrace 2e-49
>gnl|CDD|144175 pfam00482, GSPII_F, Bacterial type II secretion system protein F domain Back     alignment and domain information
>gnl|CDD|32247 COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|31648 COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|34572 COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 187 pilus assembly protein [Candidatus Liberibacter asiatic
COG4965309 TadB Flp pilus assembly protein TadB [Intracellular tra 100.0
TIGR02120 414 GspF general secretion pathway protein F; InterPro: IPR 99.77
PRK10573 397 type IV pilin biogenesis protein; Provisional 99.73
COG1459 397 PulF Type II secretory pathway, component PulF [Cell mo 99.68
PRK06041 547 flagellar assembly protein J; Reviewed 99.58
pfam00482125 GSPII_F Bacterial type II secretion system protein F do 99.47
TIGR02120414 GspF general secretion pathway protein F; InterPro: IPR 99.13
COG2064320 TadC Flp pilus assembly protein TadC [Cell motility and 99.56
PRK06041547 flagellar assembly protein J; Reviewed 99.47
COG1955 527 FlaJ Archaeal flagella assembly protein J [Cell motilit 99.19
PRK10573397 type IV pilin biogenesis protein; Provisional 99.15
COG1955527 FlaJ Archaeal flagella assembly protein J [Cell motilit 99.0
COG1459397 PulF Type II secretory pathway, component PulF [Cell mo 98.99
pfam09548170 Spore_III_AB Stage III sporulation protein AB (spore_II 97.16
PRK08307172 stage III sporulation protein SpoAB; Provisional 96.62
TIGR02833170 spore_III_AB stage III sporulation protein AB; InterPro 96.61
PRK09546327 zntB zinc transporter; Reviewed 92.62
>COG4965 TadB Flp pilus assembly protein TadB [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02120 GspF general secretion pathway protein F; InterPro: IPR011850 This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the "Type II" secretion pathway Back     alignment and domain information
>PRK10573 type IV pilin biogenesis protein; Provisional Back     alignment and domain information
>COG1459 PulF Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06041 flagellar assembly protein J; Reviewed Back     alignment and domain information
>pfam00482 GSPII_F Bacterial type II secretion system protein F domain Back     alignment and domain information
>TIGR02120 GspF general secretion pathway protein F; InterPro: IPR011850 This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the "Type II" secretion pathway Back     alignment and domain information
>COG2064 TadC Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06041 flagellar assembly protein J; Reviewed Back     alignment and domain information
>COG1955 FlaJ Archaeal flagella assembly protein J [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10573 type IV pilin biogenesis protein; Provisional Back     alignment and domain information
>COG1955 FlaJ Archaeal flagella assembly protein J [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1459 PulF Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam09548 Spore_III_AB Stage III sporulation protein AB (spore_III_AB) Back     alignment and domain information
>PRK08307 stage III sporulation protein SpoAB; Provisional Back     alignment and domain information
>TIGR02833 spore_III_AB stage III sporulation protein AB; InterPro: IPR014198 This entry represents the stage III sporulation protein AB, which is encoded in a spore formation operon: spoIIIAABCDEFGH that is under sigma G regulation Back     alignment and domain information
>PRK09546 zntB zinc transporter; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target187 pilus assembly protein [Candidatus Liberibacter asiatic
2vmb_A123 The Three-Dimensional Structure Of The Cytoplasmic 2e-06
2whn_A116 N-Terminal Domain From The Pilc Type Iv Pilus Bioge 4e-06
2vma_A123 The Three-Dimensional Structure Of The Cytoplasmic 5e-06
3c1q_A123 The Three-Dimensional Structure Of The Cytoplasmic 1e-05
>gi|223365710|pdb|2VMB|A Chain A, The Three-Dimensional Structure Of The Cytoplasmic Domains Of Epsf From The Type 2 Secretion System Of Vibrio Cholerae Length = 123 Back     alignment and structure
 Score = 56.3 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/110 (19%), Positives = 43/110 (39%), Gaps = 6/110 (5%)

Query: 15  DFPNALDIIVRSVRAGLPVSDAVAVIVGQSS-DPVRSEFRRVIETQHLGLSLSESISRMV 73
           D       +   V++G+P+ + +  +  QS    +R+    V      G +LS+S+    
Sbjct: 13  DLALITRQLATLVQSGMPLEECLRAVAEQSEKPRIRTMLVAVRAKVTEGYTLSDSLGDYP 72

Query: 74  RYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALS 123
                         +    +  G+L   L  L+    +R+ M++K+Q  S
Sbjct: 73  -----HVFDELFRSMVAAGEKSGHLDSVLERLADYAENRQKMRSKLQQAS 117


>gi|296278289|pdb|2WHN|A Chain A, N-Terminal Domain From The Pilc Type Iv Pilus Biogenesis Protein Length = 116 Back     alignment and structure
>gi|223365708|pdb|2VMA|A Chain A, The Three-Dimensional Structure Of The Cytoplasmic Domains Of Epsf From The Type 2 Secretion System Of Vibrio Cholerae Length = 123 Back     alignment and structure
>gi|222447018|pdb|3C1Q|A Chain A, The Three-Dimensional Structure Of The Cytoplasmic Domains Of Epsf From The Type 2 Secretion System Of Vibrio Cholerae Length = 123 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target187 pilus assembly protein [Candidatus Liberibacter asiatic
3c1q_A123 General secretion pathway protein F; type 2 secretion s 1e-04
>3c1q_A General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* Length = 123 Back     alignment and structure
 Score = 41.5 bits (97), Expect = 1e-04
 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 6/99 (6%)

Query: 27  VRAGLPVSDAVAVIVGQSSDPV-RSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFS 85
           V++G+P+ + +  +  QS  P  R+    V      G +LS+S+              F 
Sbjct: 25  VQSGMPLEECLRAVAEQSEKPRIRTMLVAVRAKVTEGYTLSDSLGDYPHVFD----ELFR 80

Query: 86  TVISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSM 124
           ++++   +  G+L   L  L+    +R+ M++K+Q  S 
Sbjct: 81  SMVAAGEK-SGHLDSVLERLADYAENRQKMRSKLQQASE 118


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target187 pilus assembly protein [Candidatus Liberibacter asiatic
3c1q_A123 General secretion pathway protein F; type 2 secretion s 99.22
2whn_A116 PILC, pilus assembly protein PILC; transport, transmemb 99.1
2iub_A363 CORA, divalent cation transport-related protein; membra 92.32
>3c1q_A General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* Back     alignment and structure
Probab=99.22  E-value=1.8e-10  Score=82.27  Aligned_cols=108  Identities=19%  Similarity=0.305  Sum_probs=94.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             9999999999999995699989999999992484-289999999998630388889999977534873479999999998
Q gi|254780722|r   13 LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQ   91 (187)
Q Consensus        13 ~~~l~~~l~~l~~~l~aG~sl~~Al~~~a~~~~~-~l~~e~~~i~~~~~~G~~~~~al~~~~~~~~~~~~~~~~~~l~~~   91 (187)
                      ..++..|.+.++.++++|.|+.+|++.+++...+ .+++.+..+..+++.|.++.+|+.+...     .|......++.+
T Consensus        11 ~~~l~~f~~~La~Ll~sGv~l~~aL~~~~~~~~~~~~~~~~~~i~~~l~~G~~ls~Al~~~~~-----~f~~~~i~mi~~   85 (123)
T 3c1q_A           11 TPDLALITRQLATLVQSGMPLEECLRAVAEQSEKPRIRTMLVAVRAKVTEGYTLSDSLGDYPH-----VFDELFRSMVAA   85 (123)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHHTCSCHHHHHHHHHHHHHHHTTCCHHHHHTTCTT-----TSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCC-----CCCHHHHHHHHH
T ss_conf             999999999999999869989999999971441289999999999999845539999987545-----586999999999


Q ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7425746899999999999999999999998643
Q gi|254780722|r   92 SQLGGNLSEALANLSRILRDRKNMKAKVQALSME  125 (187)
Q Consensus        92 ~~~gg~~~~~L~~la~~~~~~~~~~~~~~~~~a~  125 (187)
                      +|.+|++.+.|.+++++++++.+++++++.+++.
T Consensus        86 GE~sG~L~~~l~~la~~~e~~~~~~~kik~A~~~  119 (123)
T 3c1q_A           86 GEKSGHLDSVLERLADYAENRQKMRSKLQQASEN  119 (123)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHHHHHHHHHHTTC--
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9874779999999999999999999999999998



>2whn_A PILC, pilus assembly protein PILC; transport, transmembrane, pilus biogenesis, protein transport; 2.05A {Thermus thermophilus} Back     alignment and structure
>2iub_A CORA, divalent cation transport-related protein; membrane protein, ION transporter; 2.9A {Thermotoga maritima} SCOP: d.328.1.1 f.17.3.1 PDB: 2hn2_A 2bbj_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 187 pilus assembly protein [Candidatus Liberibacter as
3c1q_A_123 (A:) General secretion pathway protein F; type 2 s 5e-12
>3c1q_A (A:) General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A*Length = 123 Back     alignment and structure
 Score = 65.3 bits (159), Expect = 5e-12
 Identities = 24/126 (19%), Positives = 49/126 (38%), Gaps = 8/126 (6%)

Query: 1   MKHLIKKRTAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDP-VRSEFRRVIETQ 59
           M    K+  +    D       +   V++G P+ + +  +  QS  P +R+    V    
Sbjct: 1   MGFAFKRGISTP--DLALITRQLATLVQSGXPLEECLRAVAEQSEKPRIRTXLVAVRAKV 58

Query: 60  HLGLSLSESISRMVRYMPLQEVSFFSTVISVQSQLGGNLSEALANLSRILRDRKNMKAKV 119
             G +LS+S+              F + ++   +  G+L   L  L+    +R+  ++K+
Sbjct: 59  TEGYTLSDSLGDYPHVFD----ELFRSXVA-AGEKSGHLDSVLERLADYAENRQKXRSKL 113

Query: 120 QALSME 125
           Q  S  
Sbjct: 114 QQASEN 119


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target187 pilus assembly protein [Candidatus Liberibacter asiatic
3c1q_A_123 General secretion pathway protein F; type 2 secret 99.46
>3c1q_A (A:) General secretion pathway protein F; type 2 secretion system, T2SS, T4PB, inner membrane, membrane, transmembrane, transport protein; HET: MSE PE5; 1.70A {Vibrio cholerae} PDB: 2vmb_A* 2vma_A* Back     alignment and structure
Probab=99.46  E-value=1.4e-12  Score=96.29  Aligned_cols=111  Identities=18%  Similarity=0.264  Sum_probs=101.9

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             9999999999999995699989999999992484-289999999998630388889999977534873479999999998
Q gi|254780722|r   13 LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSD-PVRSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTVISVQ   91 (187)
Q Consensus        13 ~~~l~~~l~~l~~~l~aG~sl~~Al~~~a~~~~~-~l~~e~~~i~~~~~~G~~~~~al~~~~~~~~~~~~~~~~~~l~~~   91 (187)
                      ..++|++++.++.++++|.|+.+|+..++++..+ +++++++.+.++++.|.++++||.+++.++|.     ....++.+
T Consensus        11 ~~~~~~f~~~l~~ll~~G~~l~~al~~~~~~~~~~~l~~~~~~i~~~l~~G~~~~~Al~~~~~~~~~-----~~~~~i~~   85 (123)
T 3c1q_A           11 TPDLALITRQLATLVQSGXPLEECLRAVAEQSEKPRIRTXLVAVRAKVTEGYTLSDSLGDYPHVFDE-----LFRSXVAA   85 (123)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHHTCSCHHHHHHHHHHHHHHHTTCCHHHHHTTCTTTSCH-----HHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCH-----HHHHHHHH
T ss_conf             9999999999999998699899999999714412899999999999998455399999875455869-----99999999


Q ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7425746899999999999999999999998643456
Q gi|254780722|r   92 SQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKA  128 (187)
Q Consensus        92 ~~~gg~~~~~L~~la~~~~~~~~~~~~~~~~~a~~~~  128 (187)
                      ++.||++.++|..+++.++++.+.+.+......+|.+
T Consensus        86 ge~~G~L~~~l~~~a~~~~~~~~~~~~~~~~l~~P~f  122 (123)
T 3c1q_A           86 GEKSGHLDSVLERLADYAENRQKXRSKLQQASENLYF  122 (123)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHHHHHHHHHHTTC-----
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9874779999999999999999999999999998850