254780723

254780723

hypothetical protein CLIBASIA_03050

GeneID in NCBI database:8209728Locus tag:CLIBASIA_03050
Protein GI in NCBI database:254780723Protein Accession:YP_003065136.1
Gene range:+(544288, 544701)Protein Length:137aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF
ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccEEccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccEcccccHHHHHHHHHHHHHHHHHccccccccccccHEEEcccccccccEEEEEEEEEEEEEEHEEEEccccHHHEEEEEHcHHcHccccc
MFDVNSWFLVGLITVSVFCFLYAIFYNvinpgdsksqdnakvvradrviptaNTKRRKELREAIQKIELNHkakigntksidsliscsglpiskqhyyIGSCVIGFICGVLSLTLSSSFFTFLCVSVssalvfprff
MFDVNSWFLVGLITVSVFCFLYAIFYNVInpgdsksqdnakvvradrviptantkrrkELREAIQKIelnhkakigntksiDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF
MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGvlsltlsssfftflcvsvssALVFPRFF
****NSWFLVGLITVSVFCFLYAIFY**********************************************************ISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF
MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF
*FDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF
MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF
MFDVNSWFLVGLITVSVFCFLYAIFYNVINPGDSKSQDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVFPRFF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target137 hypothetical protein CLIBASIA_03050 [Candidatus Liberib
315121887 328 pilus assembly protein [Candidatus Liberibacter solanac 1 1e-29
170740617 322 type II secretion system protein [Methylobacterium sp. 1 9e-06
153008063 337 type II secretion system protein [Ochrobactrum anthropi 1 1e-04
328545275 339 Bacterial type II secretion system protein F domain [po 1 3e-04
163757631 336 hypothetical protein HPDFL43_19512 [Hoeflea phototrophi 1 6e-04
218461009 335 probable pilus assembly protein [Rhizobium etli Kim 5] 1 6e-04
116249985 335 pilus assembly protein [Rhizobium leguminosarum bv. vic 1 9e-04
190889885 335 pilus assembly protein [Rhizobium etli CIAT 652] Length 1 0.001
218516696 335 probable pilus assembly protein [Rhizobium etli 8C-3] L 1 0.001
13474664 337 hypothetical protein mlr5603 [Mesorhizobium loti MAFF30 1 0.002
>gi|315121887|ref|YP_004062376.1| pilus assembly protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 328 Back     alignment and organism information
 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 98/137 (71%), Gaps = 3/137 (2%)

Query: 2   FDVNSWFLVGLITVSVFCFLYAIFYNVIN-PGDSKSQDNAKVVRADR--VIPTANTKRRK 58
            D+NS+ LVGLI++SVF  LY + +        S+S+D  KV++  +   IP+A  KRRK
Sbjct: 3   LDINSFLLVGLISISVFFLLYFLLFKTTGLESSSESRDPKKVIKDKKNDTIPSAAVKRRK 62

Query: 59  ELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGVLSLTLSSS 118
            LR+A+ KIEL+HK K GNTKS+ SLIS SG+P SK+H+YI SCV+G + G++SL L SS
Sbjct: 63  VLRDAMDKIELSHKEKFGNTKSLSSLISYSGIPFSKEHFYIFSCVMGLVFGIISLALFSS 122

Query: 119 FFTFLCVSVSSALVFPR 135
           FF  LCV +SSALV PR
Sbjct: 123 FFVSLCVCLSSALVVPR 139


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|170740617|ref|YP_001769272.1| type II secretion system protein [Methylobacterium sp. 4-46] Length = 322 Back     alignment and organism information
>gi|153008063|ref|YP_001369278.1| type II secretion system protein [Ochrobactrum anthropi ATCC 49188] Length = 337 Back     alignment and organism information
>gi|328545275|ref|YP_004305384.1| Bacterial type II secretion system protein F domain [polymorphum gilvum SL003B-26A1] Length = 339 Back     alignment and organism information
>gi|163757631|ref|ZP_02164720.1| hypothetical protein HPDFL43_19512 [Hoeflea phototrophica DFL-43] Length = 336 Back     alignment and organism information
>gi|218461009|ref|ZP_03501100.1| probable pilus assembly protein [Rhizobium etli Kim 5] Length = 335 Back     alignment and organism information
>gi|116249985|ref|YP_765823.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841] Length = 335 Back     alignment and organism information
>gi|190889885|ref|YP_001976427.1| pilus assembly protein [Rhizobium etli CIAT 652] Length = 335 Back     alignment and organism information
>gi|218516696|ref|ZP_03513536.1| probable pilus assembly protein [Rhizobium etli 8C-3] Length = 335 Back     alignment and organism information
>gi|13474664|ref|NP_106233.1| hypothetical protein mlr5603 [Mesorhizobium loti MAFF303099] Length = 337 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 137 hypothetical protein CLIBASIA_03050 [Candidatus Liberib
COG4965 309 TadB Flp pilus assembly protein TadB [Intracellular tra 99.57
COG3167211 PilO Tfp pilus assembly protein PilO [Cell motility and 95.43
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 90.27
>COG4965 TadB Flp pilus assembly protein TadB [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3167 PilO Tfp pilus assembly protein PilO [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target137 hypothetical protein CLIBASIA_03050 [Candidatus Liberib
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 0.003
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 35.7 bits (81), Expect = 0.003
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query: 42  VVRADRVI--PTANTKRRKELREAIQKIELNHKAKI 75
           + +ADR+   P +  K R+E R+ +Q  EL+  +K+
Sbjct: 74  IAQADRLTQEPESIRKWREEQRKRLQ--ELDAASKV 107


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00