254780724

254780724

component of type IV pilus

GeneID in NCBI database:8209729Locus tag:CLIBASIA_03055
Protein GI in NCBI database:254780724Protein Accession:YP_003065137.1
Gene range:+(542825, 544276)Protein Length:483aa
Gene description:component of type IV pilus
COG prediction:[U] Flp pilus assembly protein, ATPase CpaF
KEGG prediction:component of type IV pilus; K02283 pilus assembly protein CpaF
SEED prediction:Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---
MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQSRAL
ccccccccccccccccccccccHHHcccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHccccccEEEEccccccEEEEccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccccEEcccccEEEEEEccccccccEEEEEEcccccccHHHHHHcccccHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEEEccccccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHEEEEEEEccccccEEEEEEEEEccccccEEEcccccccccccccccccccEEEEcccccHHHHHHHHHccccHHHHHHHHHHHHHHHcc
cccccccccccEccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHccccHHHEEEcccccEEEEEccEEEEEcEEEccHHHHHHHHHHHHHHHccccccccccEccccccccEEEEEEcccccccccEEHHHcccccccHHHHHHcccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHcccccEEEEEccHHHHHHccccEEEEEcccccccccccEcHHHHHHHHHHcccccEEEEccccHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEEEEEcccccccEEEEEEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHcc
mfgrrdkklmgsvkrednnplpqevVVSSsniqkqnlqssspsaegeignfvnrtphyyeVKSTIFTTLIEMIDitqlsqydsQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNdilgygplqpliarddiaDIMVNGSNKVFIEVNgktvetginfrdneQLLSVCQRIVNQvgrrvdesspicdarlldgsrvnviipplaldgptltiRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNvlisggtgsgktTLLNCLTryidkderivtcedtaelqlqqphvvrletrppniegegeiTMRDLVKNCLRMrperiilgevrgpEVLDLLQAMntghdgsmgtihannareSFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIvgmegnviitQDLLKyevmgedetgkligqhistgvsrprFWNRAAQYGEEKNLAEVLQSLEKQSRAL
mfgrrdkklmgsvkrednnplpqevvvsssniqkqnlqssspsaegEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGinfrdneqlLSVCQRIVNqvgrrvdesspicdarlldgsrvnviipplaldgptlTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVlisggtgsgkttlLNCLTRYIDKDERIVTCEDTaelqlqqphvvrletrppniegegeitmrDLVKNCLRMRPEriilgevrgpEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQtqrlrdgsrritniceivgmegnviiTQDLLKYEVMGEDETGKLIgqhistgvsrPRFWNRAAQYGEEKNLAEVLQSlekqsral
MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLIsggtgsgkttLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQSRAL
************************************************************VKSTIFTTLIEMIDI*************EIATLMNEIVSVKKI*MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE******
**********GSVKREDNNPLPQEVVVSS***************EGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQSRAL
**GRRDKKLMGSVKREDNNPLPQEVVVSSSNI*********************RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQSRAL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQSRAL
MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQSRAL
MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQSRAL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target483 component of type IV pilus [Candidatus Liberibacter asi
315121888488 component of type IV pilus [Candidatus Liberibacter sol 1 0.0
325291656490 component of type IV pilus [Agrobacterium sp. H13-3] Le 1 0.0
159184215491 component of type IV pilus [Agrobacterium tumefaciens s 1 0.0
209551762491 type II secretion system protein E [Rhizobium leguminos 1 0.0
241207160491 type II secretion system protein E [Rhizobium leguminos 1 0.0
116249984491 component of pilus [Rhizobium leguminosarum bv. viciae 1 0.0
190889884492 pilus assembly secretion ATP-binding protein [Rhizobium 1 0.0
163757630501 putative pilus assembly protein [Hoeflea phototrophica 1 0.0
86355867491 pilus assembly secretion ATP-binding protein [Rhizobium 1 0.0
222084472438 pilus assembly secretion ATP-binding protein [Agrobacte 1 0.0
>gi|315121888|ref|YP_004062377.1| component of type IV pilus [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 488 Back     alignment and organism information
 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/488 (80%), Positives = 433/488 (88%), Gaps = 8/488 (1%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNL----QSSSPSAEGEIG--NFV-N 53
           MFG+R+K  +GS  RE N  L QE       I+        QSS      E+G  N + +
Sbjct: 1   MFGKREKGPIGSANRE-NFKLRQEKAQQGKEIEDSGSDGTNQSSFLDQSSELGLPNILKH 59

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ HYY++K+T+F TLIEMIDIT+LSQYD + A+ EIA LM+EI+S+K I M  +E+ DL
Sbjct: 60  RSSHYYDIKATVFGTLIEMIDITKLSQYDGELAKKEIAELMDEIISIKDIVMPFEEKEDL 119

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            EDL NDILGYGPLQPLIARDDIADIMVNG +KVFIEVNGKT+ETGI+FR+NEQLLSVCQ
Sbjct: 120 LEDLSNDILGYGPLQPLIARDDIADIMVNGPDKVFIEVNGKTIETGISFRNNEQLLSVCQ 179

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIVNQVGRRVDE+SPICDARLLDGSRVNVIIPPLALDG TLTIRKFKKDKLTLDHLV FG
Sbjct: 180 RIVNQVGRRVDEASPICDARLLDGSRVNVIIPPLALDGATLTIRKFKKDKLTLDHLVRFG 239

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T  G++LLQIIGR+RCN+LISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ
Sbjct: 240 AITEAGSQLLQIIGRVRCNILISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 299

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS
Sbjct: 300 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 359

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHANN RESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC
Sbjct: 360 MGTIHANNPRESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 419

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E+VGMEGNVIITQDL+KY+V+G+DE+GKLIG H+ +GVSRPRFWNRAAQYGEEKNLAEVL
Sbjct: 420 EVVGMEGNVIITQDLIKYDVIGQDESGKLIGHHVGSGVSRPRFWNRAAQYGEEKNLAEVL 479

Query: 474 QSLEKQSR 481
           +S+EKQ R
Sbjct: 480 ESVEKQPR 487


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291656|ref|YP_004277520.1| component of type IV pilus [Agrobacterium sp. H13-3] Length = 490 Back     alignment and organism information
>gi|159184215|ref|NP_353251.2| component of type IV pilus [Agrobacterium tumefaciens str. C58] Length = 491 Back     alignment and organism information
>gi|209551762|ref|YP_002283679.1| type II secretion system protein E [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 491 Back     alignment and organism information
>gi|241207160|ref|YP_002978256.1| type II secretion system protein E [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 491 Back     alignment and organism information
>gi|116249984|ref|YP_765822.1| component of pilus [Rhizobium leguminosarum bv. viciae 3841] Length = 491 Back     alignment and organism information
>gi|190889884|ref|YP_001976426.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CIAT 652] Length = 492 Back     alignment and organism information
>gi|163757630|ref|ZP_02164719.1| putative pilus assembly protein [Hoeflea phototrophica DFL-43] Length = 501 Back     alignment and organism information
>gi|86355867|ref|YP_467759.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CFN 42] Length = 491 Back     alignment and organism information
>gi|222084472|ref|YP_002543001.1| pilus assembly secretion ATP-binding protein [Agrobacterium radiobacter K84] Length = 438 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target483 component of type IV pilus [Candidatus Liberibacter asi
TIGR03819340 TIGR03819, heli_sec_ATPase, helicase/secretion neighbor 2e-90
pfam00437283 pfam00437, GSPII_E, Type II/IV secretion system protein 2e-67
COG0630312 COG0630, VirB11, Type IV secretory pathway, VirB11 comp 3e-57
TIGR02788308 TIGR02788, VirB11, P-type DNA transfer ATPase VirB11 4e-57
TIGR02782299 TIGR02782, TrbB_P, P-type conjugative transfer ATPase T 6e-52
PRK13894319 PRK13894, PRK13894, conjugal transfer ATPase TrbB; Prov 3e-44
PRK13900332 PRK13900, PRK13900, type IV secretion system ATPase Vir 6e-42
PRK13833323 PRK13833, PRK13833, conjugal transfer protein TrbB; Pro 3e-36
COG2805353 COG2805, PilT, Tfp pilus assembly protein, pilus retrac 6e-11
cd01130186 cd01130, VirB11-like_ATPase, Type IV secretory pathway 2e-66
COG2804500 COG2804, PulE, Type II secretory pathway, ATPase PulE/T 2e-14
cd01129264 cd01129, PulE-GspE, PulE/GspE The type II secretory pat 1e-12
TIGR01420343 TIGR01420, pilT_fam, pilus retraction protein PilT 6e-11
cd01131198 cd01131, PilT, Pilus retraction ATPase PilT 3e-10
TIGR02538564 TIGR02538, type_IV_pilB, type IV-A pilus assembly ATPas 6e-09
PRK10436462 PRK10436, PRK10436, hypothetical protein; Provisional 3e-05
PRK13851344 PRK13851, PRK13851, type IV secretion system protein Vi 3e-23
TIGR02525372 TIGR02525, plasmid_TraJ, plasmid transfer ATPase TraJ 2e-09
COG5008375 COG5008, PilU, Tfp pilus assembly protein, ATPase PilU 3e-09
TIGR02533486 TIGR02533, type_II_gspE, general secretory pathway prot 3e-07
TIGR02524358 TIGR02524, dot_icm_DotB, Dot/Icm secretion system ATPas 5e-06
smart00382148 smart00382, AAA, ATPases associated with a variety of c 8e-05
COG4962355 COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF 1e-128
>gnl|CDD|163531 TIGR03819, heli_sec_ATPase, helicase/secretion neighborhood ATPase Back     alignment and domain information
>gnl|CDD|109493 pfam00437, GSPII_E, Type II/IV secretion system protein Back     alignment and domain information
>gnl|CDD|30975 COG0630, VirB11, Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|163021 TIGR02788, VirB11, P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>gnl|CDD|163017 TIGR02782, TrbB_P, P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>gnl|CDD|184377 PRK13894, PRK13894, conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>gnl|CDD|184381 PRK13900, PRK13900, type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>gnl|CDD|172360 PRK13833, PRK13833, conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>gnl|CDD|32636 COG2805, PilT, Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|29996 cd01130, VirB11-like_ATPase, Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>gnl|CDD|32635 COG2804, PulE, Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|29995 cd01129, PulE-GspE, PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>gnl|CDD|162351 TIGR01420, pilT_fam, pilus retraction protein PilT Back     alignment and domain information
>gnl|CDD|29997 cd01131, PilT, Pilus retraction ATPase PilT Back     alignment and domain information
>gnl|CDD|162908 TIGR02538, type_IV_pilB, type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>gnl|CDD|182459 PRK10436, PRK10436, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172375 PRK13851, PRK13851, type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>gnl|CDD|131577 TIGR02525, plasmid_TraJ, plasmid transfer ATPase TraJ Back     alignment and domain information
>gnl|CDD|34613 COG5008, PilU, Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131585 TIGR02533, type_II_gspE, general secretory pathway protein E Back     alignment and domain information
>gnl|CDD|131576 TIGR02524, dot_icm_DotB, Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|34569 COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 483 component of type IV pilus [Candidatus Liberibacter asi
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 100.0
COG1855 604 ATPase (PilT family) [General function prediction only] 99.69
PRK13900332 type IV secretion system ATPase VirB11; Provisional 100.0
PRK13833323 conjugal transfer protein TrbB; Provisional 100.0
PRK13894320 conjugal transfer ATPase TrbB; Provisional 100.0
PRK13851343 type IV secretion system protein VirB11; Provisional 100.0
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 100.0
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 100.0
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 100.0
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 100.0
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 100.0
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 100.0
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 100.0
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 100.0
PRK10436461 hypothetical protein; Provisional 100.0
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 100.0
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 100.0
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB; Inte 99.9
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 99.42
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 100.0
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 100.0
PRK00440318 rfc replication factor C small subunit; Reviewed 97.94
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.94
PRK04195 403 replication factor C large subunit; Provisional 97.82
PRK06067241 flagellar accessory protein FlaH; Validated 97.79
PRK12402337 replication factor C small subunit 2; Reviewed 97.79
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 97.71
PRK08903227 hypothetical protein; Validated 97.51
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 97.45
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 97.39
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 97.37
pfam00308219 Bac_DnaA Bacterial dnaA protein. 97.32
pfam06745231 KaiC KaiC. This family represents a conserved region wi 97.3
PRK11823 454 DNA repair protein RadA; Provisional 97.27
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 97.11
PRK08084235 DNA replication initiation factor; Provisional 97.02
PRK05642234 DNA replication initiation factor; Validated 96.97
KOG0054 1381 consensus 96.92
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 96.89
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 96.8
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 96.79
PRK13407334 bchI magnesium chelatase subunit I; Provisional 96.73
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 96.72
PRK08727233 hypothetical protein; Validated 96.66
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 96.54
PRK06893229 DNA replication initiation factor; Validated 96.32
PTZ00088225 adenylate kinase 1; Provisional 96.27
pfam04665241 Pox_A32 Poxvirus A32 protein. The A32 protein is though 96.06
TIGR012711534 CFTR_protein cystic fibrosis transmembrane conductor re 95.72
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 95.61
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 95.49
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 95.36
PRK09087226 hypothetical protein; Validated 95.36
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 100.0
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 95.32
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 99.96
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 99.3
PRK13764 605 ATPase; Provisional 99.79
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 98.01
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.53
KOG0735 952 consensus 97.2
pfam05049375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 97.05
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.02
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 96.7
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 96.3
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.82
PRK10416499 cell division protein FtsY; Provisional 95.71
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 95.42
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 95.33
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 95.29
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.88
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.84
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 97.84
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.8
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 97.78
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.72
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 97.67
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 97.65
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 97.63
PRK10865857 protein disaggregation chaperone; Provisional 97.62
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 97.61
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 97.61
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 97.6
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 97.59
COG0523323 Putative GTPases (G3E family) [General function predict 97.54
PTZ002431560 ABC transporter; Provisional 97.5
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.5
CHL00095823 clpC Clp protease ATP binding subunit 97.5
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 97.48
pfam00625182 Guanylate_kin Guanylate kinase. 97.45
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 97.42
PRK13695174 putative NTPase; Provisional 97.4
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 97.35
PRK11537317 putative GTP-binding protein YjiA; Provisional 97.21
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.2
COG4178604 ABC-type uncharacterized transport system, permease and 97.19
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 97.16
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.12
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.03
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 96.97
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 96.95
COG3596296 Predicted GTPase [General function prediction only] 96.89
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 96.86
KOG00541381 consensus 96.8
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.77
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 96.73
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 96.68
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 96.67
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.66
KOG0057591 consensus 96.63
KOG1051898 consensus 96.61
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 96.45
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 96.41
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 96.39
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.39
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 96.37
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 96.3
COG1341398 Predicted GTPase or GTP-binding protein [General functi 96.3
PRK13536306 nodulation factor exporter subunit NodI; Provisional 96.29
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 96.29
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 96.21
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.09
COG4987573 CydC ABC-type transport system involved in cytochrome b 96.03
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 95.93
PRK06835330 DNA replication protein DnaC; Validated 95.9
PRK06526254 transposase; Provisional 95.77
PRK09183258 transposase/IS protein; Provisional 95.69
PRK12377248 putative replication protein; Provisional 95.68
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 95.66
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 95.62
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 95.62
PHA00520326 packaging NTPase P4 95.54
PRK08181269 transposase; Validated 95.45
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 95.4
PRK11784333 tRNA 2-selenouridine synthase; Provisional 95.35
COG1484254 DnaC DNA replication protein [DNA replication, recombin 95.32
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 95.3
pfam00265175 TK Thymidine kinase. 95.24
PRK04328250 hypothetical protein; Provisional 97.85
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.42
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 97.35
PRK10636638 putative ABC transporter ATP-binding protein; Provision 97.32
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.3
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.29
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 97.18
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 97.14
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 97.13
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.13
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 97.11
COG4619223 ABC-type uncharacterized transport system, ATPase compo 97.05
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 96.99
COG0488530 Uup ATPase components of ABC transporters with duplicat 96.97
PRK06696227 uridine kinase; Validated 96.96
PRK00149447 dnaA chromosomal replication initiation protein; Review 96.93
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 96.85
smart00487201 DEXDc DEAD-like helicases superfamily. 96.77
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 96.71
KOG0060659 consensus 96.61
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 96.57
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 96.39
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 96.25
PRK10646153 putative ATPase; Provisional 96.25
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 96.18
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 96.17
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 96.17
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 95.93
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 95.91
PRK09700510 D-allose transporter ATP-binding protein; Provisional 95.77
PRK09435325 arginine/ornithine transport system ATPase; Provisional 95.51
COG0802149 Predicted ATPase or kinase [General function prediction 95.48
pfam06431417 Polyoma_lg_T_C Polyomavirus large T antigen C-terminus. 95.45
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 95.44
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.41
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.39
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.39
TIGR03005256 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, AT 95.38
PRK01889353 ribosome-associated GTPase; Reviewed 95.35
PRK09862506 putative ATP-dependent protease; Provisional 95.34
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 95.17
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 97.81
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 97.76
smart00382148 AAA ATPases associated with a variety of cellular activ 97.75
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 97.66
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.6
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 97.3
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.3
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 97.29
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 97.27
cd03112158 CobW_like The function of this protein family is unkown 97.24
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.13
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 97.13
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.12
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.03
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 97.02
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.0
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.0
COG1123539 ATPase components of various ABC-type transport systems 96.95
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 96.91
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 96.89
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 96.88
pfam00004131 AAA ATPase family associated with various cellular acti 96.87
PRK08118167 topology modulation protein; Reviewed 96.77
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 96.73
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 96.71
PRK07261171 topology modulation protein; Provisional 96.6
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 96.59
PRK03992390 proteasome-activating nucleotidase; Provisional 96.55
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.41
KOG0733 802 consensus 96.38
CHL00176 631 ftsH cell division protein; Validated 96.26
KOG0926 1172 consensus 96.1
PRK07952242 DNA replication protein DnaC; Validated 96.09
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 95.98
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 95.96
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 95.75
PRK05541176 adenylylsulfate kinase; Provisional 95.41
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 95.38
KOG1532 366 consensus 95.18
PTZ00243 1560 ABC transporter; Provisional 97.8
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.51
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.46
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.43
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.42
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 97.42
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.41
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 97.4
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.4
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 97.4
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.38
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 97.38
PRK13544208 consensus 97.37
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.36
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.36
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.35
cd01124187 KaiC KaiC is a circadian clock protein primarily found 97.34
PRK09302 501 circadian clock protein KaiC; Reviewed 97.34
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.34
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 97.33
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.33
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.32
PRK08233182 hypothetical protein; Provisional 97.3
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.3
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 97.27
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 97.27
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.25
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.25
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.24
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.23
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 97.22
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 97.22
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 97.21
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.21
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 97.2
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 97.2
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.19
PRK13542224 consensus 97.18
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 97.18
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 97.17
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.17
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 97.17
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 97.16
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.16
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.15
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 97.14
PRK13853 789 type IV secretion system protein VirB4; Provisional 97.13
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 97.13
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.13
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.1
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.1
PRK13830 818 conjugal transfer protein TrbE; Provisional 97.09
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.09
PRK00300208 gmk guanylate kinase; Provisional 97.08
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.08
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.08
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 97.08
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 97.06
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 97.06
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.06
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.06
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.05
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 97.04
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.04
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.03
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 97.02
PRK07667190 uridine kinase; Provisional 97.01
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.01
COG3839338 MalK ABC-type sugar transport systems, ATPase component 97.01
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 97.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.0
PRK13898 800 type IV secretion system ATPase VirB4; Provisional 96.99
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.99
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 96.98
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 96.98
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.97
cd03234226 ABCG_White The White subfamily represents ABC transport 96.97
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.97
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 96.96
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 96.96
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 96.96
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.96
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 96.95
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 96.95
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 96.95
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 96.94
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 96.93
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 96.93
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 96.92
PRK13873 815 conjugal transfer ATPase TrbE; Provisional 96.92
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 96.92
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 96.92
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 96.91
PRK10908222 cell division protein FtsE; Provisional 96.91
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 96.9
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.9
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 96.89
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 96.89
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.88
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.88
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 96.88
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.88
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.88
PRK07429331 phosphoribulokinase; Provisional 96.87
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.87
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.86
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 96.86
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 96.85
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.85
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 96.84
cd03114148 ArgK-like The function of this protein family is unkown 96.84
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 96.84
PRK13891 852 conjugal transfer protein TrbE; Provisional 96.84
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 96.84
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.83
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.83
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 96.83
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 96.82
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 96.82
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.82
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 96.81
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 96.8
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.8
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 96.8
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 96.79
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 96.79
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 96.78
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.77
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 96.77
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 96.76
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 96.75
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 96.75
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.74
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.74
PRK11147632 ABC transporter ATPase component; Reviewed 96.74
PRK05480209 uridine kinase; Provisional 96.72
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 96.72
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 96.71
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components [Intr 96.71
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 96.7
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 96.69
PTZ00301210 uridine kinase; Provisional 96.69
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.68
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 96.68
PRK09984262 phosphonate/organophosphate ester transporter subunit; 96.67
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 96.66
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 96.66
KOG09521230 consensus 96.65
PRK03695245 vitamin B12-transporter ATPase; Provisional 96.64
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 96.64
PRK09270230 frcK putative fructose transport system kinase; Reviewe 96.64
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 96.64
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 96.63
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 96.63
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.62
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 96.61
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 96.61
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.61
PRK09700510 D-allose transporter ATP-binding protein; Provisional 96.61
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 96.61
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 96.6
COG4525259 TauB ABC-type taurine transport system, ATPase componen 96.59
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 96.59
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 96.54
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 96.54
PRK13768253 GTPase; Provisional 96.53
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 96.52
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 96.51
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 96.51
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 96.49
PRK13549513 xylose transporter ATP-binding subunit; Provisional 96.49
COG3911183 Predicted ATPase [General function prediction only] 96.49
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 96.48
KOG0055 1228 consensus 96.46
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 96.44
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 96.42
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 96.41
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 96.4
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 96.4
pfam121281192 DUF3584 Protein of unknown function (DUF3584). This pro 96.36
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 96.35
COG4559259 ABC-type hemin transport system, ATPase component [Inor 96.34
PRK13700 732 conjugal transfer protein TraD; Provisional 96.34
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 96.32
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 96.3
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 96.28
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 96.26
COG1119257 ModF ABC-type molybdenum transport system, ATPase compo 96.25
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 96.23
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 96.21
COG0410237 LivF ABC-type branched-chain amino acid transport syste 96.18
PRK13409590 putative ATPase RIL; Provisional 96.16
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 96.16
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 96.15
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 96.14
COG4107258 PhnK ABC-type phosphonate transport system, ATPase comp 96.11
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 96.11
KOG0061 613 consensus 96.11
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.1
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 96.01
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 95.98
COG4133209 CcmA ABC-type transport system involved in cytochrome c 95.95
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 95.9
pfam04851103 ResIII Type III restriction enzyme, res subunit. 95.87
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 95.86
COG1127263 Ttg2A ABC-type transport system involved in resistance 95.86
pfam00350168 Dynamin_N Dynamin family. 95.81
KOG0924 1042 consensus 95.75
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 95.71
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 95.62
PTZ002651467 multidrug resistance protein (mdr1); Provisional 95.59
PRK13721 864 conjugal transfer ATP-binding protein TraC; Provisional 95.53
COG1100219 GTPase SAR1 and related small G proteins [General funct 95.51
TIGR02759 613 TraD_Ftype type IV conjugative transfer system coupling 95.48
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 95.47
PRK06547184 hypothetical protein; Provisional 95.44
TIGR02142 361 modC_ABC molybdate ABC transporter, ATP-binding protein 95.43
COG0411250 LivG ABC-type branched-chain amino acid transport syste 95.39
TIGR00150147 TIGR00150 conserved hypothetical protein TIGR00150; Int 95.37
PRK00131175 aroK shikimate kinase; Reviewed 95.32
COG4148352 ModC ABC-type molybdate transport system, ATPase compon 95.3
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.17
PRK09302501 circadian clock protein KaiC; Reviewed 97.8
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 96.8
PRK102461047 exonuclease subunit SbcC; Provisional 97.4
PRK03918882 chromosome segregation protein; Provisional 96.78
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.74
PRK06647560 DNA polymerase III subunits gamma and tau; Validated 95.51
PRK13342 417 recombination factor protein RarA; Reviewed 97.03
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 97.01
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 97.0
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 96.85
PRK06217185 hypothetical protein; Validated 96.68
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.52
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.37
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 96.36
PRK10744257 phosphate transporter subunit; Provisional 96.04
KOG1970 634 consensus 96.01
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 95.98
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 95.93
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 95.92
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 95.83
COG5019 373 CDC3 Septin family protein [Cell division and chromosom 95.73
KOG0922 674 consensus 95.7
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.47
PRK01172 674 ski2-like helicase; Provisional 95.46
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 95.32
KOG2373514 consensus 95.29
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 95.25
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 97.0
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 96.18
PRK00254717 ski2-like helicase; Provisional 95.45
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 96.94
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 96.92
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.89
PRK10762501 D-ribose transporter ATP binding protein; Provisional 96.69
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.59
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 95.51
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 95.41
COG4172534 ABC-type uncharacterized transport system, duplicated A 96.61
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 96.54
PRK10636638 putative ABC transporter ATP-binding protein; Provision 96.47
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 96.39
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 96.26
PRK10762501 D-ribose transporter ATP binding protein; Provisional 95.85
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 96.46
PRK11147632 ABC transporter ATPase component; Reviewed 96.45
PRK01156895 chromosome segregation protein; Provisional 96.38
PRK02224880 chromosome segregation protein; Provisional 95.86
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 96.33
PRK13796367 GTP-binding protein YqeH; Provisional 96.24
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 95.26
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 96.21
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 95.89
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 95.87
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 95.66
COG1123539 ATPase components of various ABC-type transport systems 95.66
PRK13341726 recombination factor protein RarA/unknown domain fusion 95.48
COG1204766 Superfamily II helicase [General function prediction on 95.39
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. This m 95.19
TIGR02475349 CobW cobalamin biosynthesis protein CobW; InterPro: IPR 95.35
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155 This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149 This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer Back     alignment and domain information
>pfam00437 GSPII_E Type II/IV secretion system protein Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374 This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IPR013364 Proteins in this entry are predicted ATPases associated with plasmid transfer loci in bacteria Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB; InterPro: IPR013363 Proteins in this entry are the DotB component of Dot/Icm secretion systems, as found in the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA; InterPro: IPR014217 Proteins in this entry include the stage III sporulation protein AA that is encoded by one of several genes in the spoIIIA locus Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 hypothetical protein; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information