254780725

254780725

response regulator receiver protein

GeneID in NCBI database:8209730Locus tag:CLIBASIA_03060
Protein GI in NCBI database:254780725Protein Accession:YP_003065138.1
Gene range:+(541529, 542812)Protein Length:427aa
Gene description:response regulator receiver protein
COG prediction:[U] Flp pilus assembly protein, ATPase CpaE
KEGG prediction:response regulator receiver protein; K02282 pilus assembly protein CpaE
SEED prediction:Type II/IV secretion system ATPase TadZ/CpaE, associated with Flp pilus assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------
MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCFS
ccccccccccccccccccHHHHccccccccEEEEEEcHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHcccccccccccHHHHccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHcccccccHHHHHcccccccHHHHHHHHccccccEEEEEcccccHHHHcccHHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccc
ccccccccccccccccccHHHHccccccEEEEEEEccHHHHHHHHHHHHccHHHHHHEEEcccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHccHHccccccEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccEEccccccccHHHHHcccccHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEEEcccHHHHccHHHHHHHHHHccccccccEEEEEEEcccccccccHHHHHHHHccccEEEccccHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccc
mnigydghnsdflenednlsesmcslprisVHVFCVTDTLYSVVerskidprmsqvnMRITRGSIAEAVscfsdsstpdliIVQTKVDSREVLSALEPLaevcdsgtkvivigdtndvSLYRALISNHVSeylieplsvaDIINSIsaiftpqeegkgssgcsisfigsrggvgsstiaHNCAFSIASVFAMETLLAdldlpygtaninfdkdpinsisdaiypvgridkafvsrlpvfyaenlsiltapamlsrtydfdekmivPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSldlaglrnsKNLIDVLKklrpadkppylvlnqvktpkkpeisisdfcaplgitpsaiipfdgavfgmsansgkmihevdpKSAIANLLVDFSRVLMgrvtvskpqsamYTKIKKIFNMKCFS
mnigydghnsdFLENEDNLSESMCSLPRISVHVFCVTDTLYsvverskidprmsqVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPlaevcdsgtkvivigDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFtpqeegkgsSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTAninfdkdpinSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTsldlaglrnsknLIDVLKklrpadkppylvlnqvktpkkpEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRvtvskpqsamytkikkifnmkcfs
MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEgkgssgcsisfigsrggVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCFS
***********************CSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSI******************SFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAML****DFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTP****ISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVL*******************IFNMKC**
MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFT*********GCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCFS
********NSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCF*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCFS
MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCFS
MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRITRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSLYRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAHNCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFYAENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKIFNMKCFS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target427 response regulator receiver protein [Candidatus Liberib
254780674423 pyruvate dehydrogenase complex dihydrolipoamide ac 0.033
>gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score = 31.2 bits (69), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 17/125 (13%)

Query: 203 YGTANINFDKDPINSISDAIY---PVGRIDKAFVSRL-------PVFYAE---NL-SILT 248
           +G  + + D + +N  +   Y   P   I K    RL       P FY     N+ ++L+
Sbjct: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232

Query: 249 APAMLSRTYDFDEKMI---VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTS 305
               ++RT  F  + I   + V DI+ + F L ++ VP    SWT   +     + I+ +
Sbjct: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292

Query: 306 LDLAG 310
           + + G
Sbjct: 293 VSIPG 297

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target427 response regulator receiver protein [Candidatus Liberib
315121889418 response regulator receiver protein [Candidatus Liberib 1 1e-160
150398543428 response regulator receiver protein [Sinorhizobium medi 1 1e-116
227823973427 pilus assembly protein CpaE [Sinorhizobium fredii NGR23 1 1e-114
241207159425 response regulator receiver protein [Rhizobium legumino 1 1e-114
116249983425 pilus assembly protein [Rhizobium leguminosarum bv. vic 1 1e-113
15963896428 putative response regulator protein [Sinorhizobium meli 1 1e-112
86355866425 pilus assembly protein, response regulator protein [Rhi 1 1e-111
209551761425 response regulator receiver protein [Rhizobium legumino 1 1e-111
327194692425 pilus assembly, two-component response regulator protei 1 1e-111
190889883425 pilus assembly, two-component response regulator protei 1 1e-111
>gi|315121889|ref|YP_004062378.1| response regulator receiver protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 418 Back     alignment and organism information
 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/424 (66%), Positives = 344/424 (81%), Gaps = 6/424 (1%)

Query: 1   MNIGYDGHNSDFLENEDNLSESMCSLPRISVHVFCVTDTLYSVVERSKIDPRMSQVNMRI 60
           M+I Y G  SD L    +      SLP IS H FCVTD+LYSV+E+SKID RM++VNMRI
Sbjct: 1   MSIEYKGSGSDVLNKHGD-----GSLPSISAHAFCVTDSLYSVIEKSKIDRRMNRVNMRI 55

Query: 61  TRGSIAEAVSCFSDSSTPDLIIVQTKVDSREVLSALEPLAEVCDSGTKVIVIGDTNDVSL 120
           T+GSI EA+  F+DS+TP+L+I+QT VDSR++LS+LEPLAEVCDS TKVIVIG+TNDV L
Sbjct: 56  TKGSITEAIDVFADSATPNLLIIQTTVDSRKILSSLEPLAEVCDSTTKVIVIGETNDVLL 115

Query: 121 YRALISNHVSEYLIEPLSVADIINSISAIFTPQEEGKGSSGCSISFIGSRGGVGSSTIAH 180
           YR LI++ +SEYLIEPLSV+DII +IS IF  ++  + S G SI+FIGSRGGVGSSTIAH
Sbjct: 116 YRELIASGISEYLIEPLSVSDIIKAISNIFV-EKNKEDSFGSSIAFIGSRGGVGSSTIAH 174

Query: 181 NCAFSIASVFAMETLLADLDLPYGTANINFDKDPINSISDAIYPVGRIDKAFVSRLPVFY 240
           NCAFSIASV A +T+LADLDLPYGTANINFD+DPI  I D I   G+ID+  V ++ V Y
Sbjct: 175 NCAFSIASVLATDTILADLDLPYGTANINFDQDPIYGILDLISSSGKIDEGLVDKIMVRY 234

Query: 241 AENLSILTAPAMLSRTYDFDEKMIVPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKV 300
            ENLSILTAPA+L  TYDFDEK I+PV+++L++I PL ILD+PH+WN W +++LTLSDKV
Sbjct: 235 VENLSILTAPAILDCTYDFDEKDILPVIELLKRIAPLTILDLPHIWNRWNRQILTLSDKV 294

Query: 301 VITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISDFCAPLGITPS 360
           VITTSLDL  LRN+KNLID L K RP DKPPYLV+NQV  PKKPEISI DFCAPLGI PS
Sbjct: 295 VITTSLDLVSLRNTKNLIDFLTKNRPNDKPPYLVINQVGMPKKPEISIDDFCAPLGIDPS 354

Query: 361 AIIPFDGAVFGMSANSGKMIHEVDPKSAIANLLVDFSRVLMGRVTVSKPQSAMYTKIKKI 420
            IIPFD  VFG+SANSGKMI E++P+S+++NLLVDFS +L+ R+T+ KP++A+Y KIK  
Sbjct: 355 VIIPFDAFVFGISANSGKMIREMNPQSSVSNLLVDFSNILLDRITIVKPKNAIYDKIKTF 414

Query: 421 FNMK 424
             +K
Sbjct: 415 LKIK 418


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150398543|ref|YP_001329010.1| response regulator receiver protein [Sinorhizobium medicae WSM419] Length = 428 Back     alignment and organism information
>gi|227823973|ref|YP_002827946.1| pilus assembly protein CpaE [Sinorhizobium fredii NGR234] Length = 427 Back     alignment and organism information
>gi|241207159|ref|YP_002978255.1| response regulator receiver protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 425 Back     alignment and organism information
>gi|116249983|ref|YP_765821.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841] Length = 425 Back     alignment and organism information
>gi|15963896|ref|NP_384249.1| putative response regulator protein [Sinorhizobium meliloti 1021] Length = 428 Back     alignment and organism information
>gi|86355866|ref|YP_467758.1| pilus assembly protein, response regulator protein [Rhizobium etli CFN 42] Length = 425 Back     alignment and organism information
>gi|209551761|ref|YP_002283678.1| response regulator receiver protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 425 Back     alignment and organism information
>gi|327194692|gb|EGE61538.1| pilus assembly, two-component response regulator protein [Rhizobium etli CNPAF512] Length = 425 Back     alignment and organism information
>gi|190889883|ref|YP_001976425.1| pilus assembly, two-component response regulator protein [Rhizobium etli CIAT 652] Length = 425 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target427 response regulator receiver protein [Candidatus Liberib
COG0455262 COG0455, COG0455, ATPases involved in chromosome partit 2e-13
COG2894272 COG2894, MinD, Septum formation inhibitor-activating AT 7e-07
TIGR01968261 TIGR01968, minD_bact, septum site-determining protein M 2e-04
COG1192259 COG1192, Soj, ATPases involved in chromosome partitioni 5e-09
cd02036179 cd02036, MinD, Bacterial cell division requires the for 0.001
cd03111106 cd03111, CpaE_like, This protein family consists of pro 2e-07
TIGR03815322 TIGR03815, CpaE_hom_Actino, helicase/secretion neighbor 1e-05
COG0489265 COG0489, Mrp, ATPases involved in chromosome partitioni 0.003
cd03111106 cd03111, CpaE_like, This protein family consists of pro 2e-05
COG4963366 COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE 2e-60
>gnl|CDD|30803 COG0455, COG0455, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|32719 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|131023 TIGR01968, minD_bact, septum site-determining protein MinD Back     alignment and domain information
>gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>gnl|CDD|73340 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>gnl|CDD|163527 TIGR03815, CpaE_hom_Actino, helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|73340 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>gnl|CDD|34570 COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 427 response regulator receiver protein [Candidatus Liberib
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intracell 100.0
CHL00175279 minD septum-site determining protein; Validated 100.0
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 100.0
PRK10818270 cell division inhibitor MinD; Provisional 100.0
TIGR01969258 minD_arch cell division ATPase MinD; InterPro: IPR01022 100.0
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 100.0
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 100.0
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 100.0
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 100.0
cd02040270 NifH NifH gene encodes component II (iron protein) of n 100.0
PRK13233275 nifH nitrogenase reductase; Reviewed 100.0
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 100.0
PRK13232273 nifH nitrogenase reductase; Reviewed 100.0
PRK13235274 nifH nitrogenase reductase; Reviewed 100.0
PRK13230292 nitrogenase reductase-like protein; Reviewed 100.0
PRK11670369 putative ATPase; Provisional 100.0
cd02032267 Bchl_like This family of proteins contains bchL and chl 100.0
PHA02518211 ParA-like protein; Provisional 100.0
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 100.0
PRK13231264 nitrogenase reductase-like protein; Reviewed 100.0
CHL00072271 chlL photochlorophyllide reductase subunit L 99.98
PRK10037250 cell division protein; Provisional 99.98
PRK13234293 nifH nitrogenase reductase; Reviewed 99.98
PRK13236295 nitrogenase reductase; Reviewed 99.97
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 99.97
TIGR01287278 nifH nitrogenase iron protein; InterPro: IPR005977 The 99.97
KOG3022300 consensus 99.95
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion t 99.95
COG1149284 MinD superfamily P-loop ATPase containing an inserted f 99.94
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 99.94
cd02033329 BchX Chlorophyllide reductase converts chlorophylls int 99.92
TIGR01281275 DPOR_bchL light-independent protochlorophyllide reducta 99.91
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 99.9
TIGR02016355 BchX chlorophyllide reductase iron protein subunit X; I 99.82
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 98.87
TIGR00379 464 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR 97.88
PRK06217185 hypothetical protein; Validated 94.44
cd02036179 MinD Bacterial cell division requires the formation of 100.0
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 100.0
PRK13869405 plasmid-partitioning protein RepA; Provisional 100.0
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 99.98
PRK13705388 plasmid-partitioning protein SopA; Provisional 99.97
PHA02519387 plasmid partition protein SopA; Reviewed 99.97
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 99.94
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 99.92
PRK13849231 putative crown gall tumor protein VirC1; Provisional 99.88
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 99.11
PRK12374231 putative dithiobiotin synthetase; Provisional 98.81
PRK00090223 bioD dithiobiotin synthetase; Reviewed 98.77
PRK13896 432 cobyrinic acid a,c-diamide synthase; Provisional 98.67
TIGR00313 502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 98.66
PRK10416499 cell division protein FtsY; Provisional 98.66
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.46
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 98.4
PRK10867 453 signal recognition particle protein; Provisional 98.39
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 98.36
PRK13768253 GTPase; Provisional 98.29
PRK00771433 signal recognition particle protein Srp54; Provisional 98.24
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 98.21
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.97
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 97.95
KOG0780 483 consensus 97.57
TIGR01425453 SRP54_euk signal recognition particle protein SRP54; In 96.62
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 96.13
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 95.97
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 93.07
cd02117212 NifH_like This family contains the NifH (iron protein) 99.97
cd03110179 Fer4_NifH_child This protein family's function is unkow 99.96
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 99.94
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 99.93
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 99.9
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 99.9
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 99.87
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 99.85
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 99.7
TIGR01005778 eps_transp_fam exopolysaccharide transport protein fami 99.56
KOG2825323 consensus 98.94
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 98.44
PRK00784 492 cobyric acid synthase; Provisional 98.4
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 98.35
PRK09435325 arginine/ornithine transport system ATPase; Provisional 98.32
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 98.31
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.25
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.22
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.06
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 97.73
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 97.73
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 97.7
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.7
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penultimate 97.67
KOG1532366 consensus 97.43
TIGR00416 481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 94.85
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 94.6
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 94.16
PRK05480209 uridine kinase; Provisional 93.66
PRK08233182 hypothetical protein; Provisional 93.31
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 93.24
PTZ00301210 uridine kinase; Provisional 92.93
PRK00089296 era GTP-binding protein Era; Reviewed 91.36
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 90.2
cd03111106 CpaE_like This protein family consists of proteins simi 99.96
PRK11519720 tyrosine kinase; Provisional 99.93
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 99.93
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 99.85
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 99.44
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 99.38
PRK13886241 conjugal transfer protein TraL; Provisional 98.73
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 97.45
cd03114148 ArgK-like The function of this protein family is unkown 97.29
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 97.28
TIGR00347187 bioD dethiobiotin synthase; InterPro: IPR004472 The enz 96.61
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.34
KOG0744423 consensus 94.89
PRK11147632 ABC transporter ATPase component; Reviewed 93.44
PRK10636638 putative ABC transporter ATP-binding protein; Provision 92.85
PRK08118167 topology modulation protein; Reviewed 92.6
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 92.26
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 91.38
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 99.91
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 99.08
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 98.29
KOG0781587 consensus 98.07
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.37
PRK07471363 DNA polymerase III subunit delta'; Validated 96.78
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 99.71
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 99.69
PRK10365441 transcriptional regulatory protein ZraR; Provisional 99.68
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 99.68
COG2204464 AtoC Response regulator containing CheY-like receiver, 99.6
TIGR02154226 PhoB phosphate regulon transcriptional regulatory prote 99.25
PRK00742345 chemotaxis-specific methylesterase; Provisional 99.14
TIGR01387219 cztR_silR_copR heavy metal response regulator; InterPro 99.1
COG3947361 Response regulator containing CheY-like receiver and SA 98.51
COG2201350 CheB Chemotaxis response regulator containing a CheY-li 97.57
pfam02399 829 Herpes_ori_bp Origin of replication binding protein. Th 91.3
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.55
PRK10430239 DNA-binding transcriptional activator DcuR; Provisional 99.48
PRK10693337 response regulator of RpoS; Provisional 99.46
PRK11083229 DNA-binding response regulator CreB; Provisional 99.42
cd00156113 REC Signal receiver domain; originally thought to be un 99.41
COG4753475 Response regulator containing CheY-like receiver domain 99.4
pfam00072111 Response_reg Response regulator receiver domain. This d 99.39
PRK09836226 DNA-binding transcriptional activator CusR; Provisional 99.37
PRK09390202 fixJ response regulator FixJ; Provisional 99.37
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.36
PRK09581457 pleD response regulator PleD; Reviewed 99.35
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 99.35
PRK09468239 ompR osmolarity response regulator; Provisional 99.35
PRK10161229 transcriptional regulator PhoB; Provisional 99.3
PRK11517223 transcriptional regulatory protein YedW; Provisional 99.3
COG0745229 OmpR Response regulators consisting of a CheY-like rece 99.29
CHL00148240 orf27 Ycf27; Reviewed 99.28
PRK10710240 DNA-binding transcriptional regulator BaeR; Provisional 99.27
PRK10643222 DNA-binding transcriptional regulator BasR; Provisional 99.26
PRK10816223 DNA-binding transcriptional regulator PhoP; Provisional 99.26
PRK09483216 response regulator; Provisional 99.25
PRK09935210 transcriptional regulator FimZ; Provisional 99.24
PRK13435141 response regulator; Provisional 99.2
PRK10651216 transcriptional regulator NarL; Provisional 99.2
PRK10701240 DNA-binding transcriptional regulator RstA; Provisional 99.2
PRK10955232 DNA-binding transcriptional regulator CpxR; Provisional 99.19
PRK10529225 DNA-binding transcriptional activator KdpE; Provisional 99.19
COG4565224 CitB Response regulator of citrate/malate metabolism [T 99.17
PRK11173237 two-component response regulator; Provisional 99.17
PRK10766224 DNA-binding transcriptional regulator TorR; Provisional 99.16
PRK10403215 transcriptional regulator NarP; Provisional 99.16
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.13
PRK13856241 two-component response regulator VirG; Provisional 99.13
PRK10840216 transcriptional regulator RcsB; Provisional 99.11
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.11
PRK12555340 chemotaxis-specific methylesterase; Provisional 99.07
COG2197211 CitB Response regulator containing a CheY-like receiver 99.05
COG4567182 Response regulator consisting of a CheY-like receiver d 99.04
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 99.01
PRK11466912 hybrid sensory histidine kinase TorS; Provisional 99.01
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.0
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.0
PRK099591197 hybrid sensory histidine kinase in two-component regula 98.92
TIGR02875270 spore_0_A sporulation transcription factor Spo0A; Inter 98.88
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 98.84
COG3437360 Response regulator containing a CheY-like receiver doma 98.75
COG3706435 PleD Response regulator containing a CheY-like receiver 98.63
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 98.53
PRK11697239 putative two-component response-regulatory protein YehT 98.44
PRK13558 674 bacterio-opsin activator; Provisional 98.04
TIGR029561052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 97.65
COG3279244 LytT Response regulator of the LytR/AlgR family [Transc 96.04
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 95.08
cd02034116 CooC The accessory protein CooC, which contains a nucle 99.51
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 97.27
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 97.11
PRK05636507 replicative DNA helicase; Provisional 97.03
KOG1533290 consensus 96.81
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 96.79
PRK06904472 replicative DNA helicase; Validated 96.72
PRK05541176 adenylylsulfate kinase; Provisional 96.42
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 96.37
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 96.31
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.17
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 95.97
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.74
PRK09302501 circadian clock protein KaiC; Reviewed 95.73
TIGR03172232 probable selenium-dependent hydroxylase accessory prote 95.21
COG4988559 CydD ABC-type transport system involved in cytochrome b 94.66
PRK13409590 putative ATPase RIL; Provisional 93.79
KOG0635207 consensus 93.56
KOG1805 1100 consensus 92.73
KOG1534273 consensus 92.57
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 91.51
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 99.17
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 97.63
cd01394218 radB RadB. The archaeal protein radB shares similarity 97.47
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 97.36
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 97.14
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 97.12
PRK08082453 consensus 97.11
PRK05595444 replicative DNA helicase; Provisional 97.1
PRK06749428 replicative DNA helicase; Provisional 97.07
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 97.06
PRK07263453 consensus 97.02
PRK05748448 replicative DNA helicase; Provisional 97.01
PRK07004460 replicative DNA helicase; Provisional 96.89
PRK06696227 uridine kinase; Validated 96.85
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 96.85
PRK08760476 replicative DNA helicase; Provisional 96.84
PRK08840464 replicative DNA helicase; Provisional 96.78
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 96.77
PRK08506473 replicative DNA helicase; Provisional 96.58
PRK08694468 consensus 96.58
PRK08006471 replicative DNA helicase; Provisional 96.56
PRK06321472 replicative DNA helicase; Provisional 96.56
PRK09165484 replicative DNA helicase; Provisional 96.54
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.51
PRK09354350 recA recombinase A; Provisional 96.51
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.48
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 96.32
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 96.21
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 96.2
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 96.11
COG0305435 DnaB Replicative DNA helicase [DNA replication, recombi 95.98
PRK07773 868 replicative DNA helicase; Validated 95.84
PRK06067241 flagellar accessory protein FlaH; Validated 95.84
PRK03846198 adenylylsulfate kinase; Provisional 95.7
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 95.64
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 95.64
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.54
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.45
smart00382148 AAA ATPases associated with a variety of cellular activ 95.45
cd03116159 MobB Molybdenum is an essential trace element in the fo 95.44
PRK05973237 replicative DNA helicase; Provisional 95.39
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.37
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.25
PRK07667190 uridine kinase; Provisional 95.23
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 95.22
TIGR02012322 tigrfam_recA protein RecA; InterPro: IPR001553 The recA 95.16
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.15
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 94.99
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.95
cd03246173 ABCC_Protease_Secretion This family represents the ABC 94.92
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 94.82
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 94.76
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 94.7
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 94.69
PRK04328250 hypothetical protein; Provisional 94.63
pfam06745231 KaiC KaiC. This family represents a conserved region wi 94.52
COG1123539 ATPase components of various ABC-type transport systems 94.41
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 94.4
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 94.4
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 94.33
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 94.33
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 94.31
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 94.2
PRK06547184 hypothetical protein; Provisional 94.12
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 93.95
PRK00139 481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 93.75
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 93.64
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 93.6
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 93.56
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 93.53
pfam02702211 KdpD Osmosensitive K+ channel His kinase sensor domain. 93.37
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 93.24
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 93.2
PRK03003474 engA GTP-binding protein EngA; Reviewed 93.14
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 93.07
PRK08327568 acetolactate synthase catalytic subunit; Validated 92.99
KOG2004 906 consensus 92.98
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 92.85
PRK10790593 putative multidrug transporter membrane\ATP-binding com 92.79
PRK10522547 multidrug transporter membrane component/ATP-binding co 92.74
cd01124187 KaiC KaiC is a circadian clock protein primarily found 92.72
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 92.6
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 92.42
PRK07261171 topology modulation protein; Provisional 92.33
PRK12338320 hypothetical protein; Provisional 92.22
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 92.18
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 92.18
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 92.06
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 91.91
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 91.86
PRK13506 577 formate--tetrahydrofolate ligase; Provisional 91.84
PRK08116262 hypothetical protein; Validated 91.83
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 91.79
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 91.56
pfam02572172 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 91.55
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 91.41
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 91.4
COG4167267 SapF ABC-type antimicrobial peptide transport system, A 91.22
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 91.18
PRK11823 454 DNA repair protein RadA; Provisional 91.08
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 90.42
PRK07952242 DNA replication protein DnaC; Validated 90.39
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 90.38
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 90.05
PRK13557538 histidine kinase; Provisional 99.15
PRK09519790 recA recombinase A; Reviewed 94.24
PRK04213195 GTP-binding protein; Provisional 90.04
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 99.1
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.42
PRK08181269 transposase; Validated 94.19
PRK01889353 ribosome-associated GTPase; Reviewed 94.16
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.63
PRK06526254 transposase; Provisional 92.99
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 92.82
pfam09818447 ABC_ATPase Predicted ATPase of the ABC class. Members o 92.78
PRK09183258 transposase/IS protein; Provisional 92.62
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.32
PRK10841947 hybrid sensory kinase in two-component regulatory syste 98.99
pfam1060981 ParA ParA/MinD ATPase like. This family contains ATPase 97.8
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 93.85
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 93.08
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 92.42
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 92.19
PRK12317 426 elongation factor 1-alpha; Reviewed 91.63
PTZ00336 449 elongation factor 1-alpha; Provisional 90.85
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 98.59
COG3707194 AmiR Response regulator with putative antiterminator ou 98.08
PRK09191261 two-component response regulator; Provisional 96.97
COG3706435 PleD Response regulator containing a CheY-like receiver 96.26
PRK09581457 pleD response regulator PleD; Reviewed 96.18
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 92.83
PRK08904207 consensus 92.64
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 92.54
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 91.81
PRK08782219 consensus 91.58
PRK08104212 consensus 90.63
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 90.19
PRK13837831 two-component VirA-like sensor kinase; Provisional 98.54
KOG0519786 consensus 98.15
cd00477524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyz 95.4
pfam01268555 FTHFS Formate--tetrahydrofolate ligase. 95.35
PRK13505556 formate--tetrahydrofolate ligase; Provisional 90.88
PRK13507587 formate--tetrahydrofolate ligase; Provisional 90.33
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 98.42
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 93.69
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.4
COG1341398 Predicted GTPase or GTP-binding protein [General functi 98.23
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 97.83
PRK05855582 short chain dehydrogenase; Validated 91.98
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 98.17
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 98.07
PRK05632 702 phosphate acetyltransferase; Reviewed 98.11
PRK00007 693 elongation factor G; Reviewed 95.75
PRK12739 693 elongation factor G; Reviewed 94.56
PTZ00141443 elongation factor 1 alpha; Provisional 92.01
COG2403449 Predicted GTPase [General function prediction only] 98.04
PRK03003474 engA GTP-binding protein EngA; Reviewed 95.49
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 97.64
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 97.62
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 97.28
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 97.11
cd00881189 GTP_translation_factor GTP translation factor family. T 96.88
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 96.69
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 96.41
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 96.39
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 95.85
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 95.67
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 95.21
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 94.33
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 94.17
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 94.07
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 94.07
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 93.71
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 93.59
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 93.47
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 93.21
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 92.73
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 92.42
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 92.37
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 92.28
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 91.05
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 91.04
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 90.65
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 90.53
KOG0448 749 consensus 90.2
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 90.04
PRK00049 397 elongation factor Tu; Reviewed 90.03
PRK00741526 prfC peptide chain release factor 3; Provisional 97.52
PRK13351687 elongation factor G; Reviewed 96.9
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 95.62
PRK07560 730 elongation factor EF-2; Reviewed 94.96
PRK12740670 elongation factor G; Reviewed 94.68
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 94.47
KOG0078207 consensus 96.76
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 96.17
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 96.0
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 95.98
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 95.91
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 95.76
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 95.7
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 95.69
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 95.54
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 95.47
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 95.43
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 95.18
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 95.09
PTZ00099176 rab6; Provisional 94.98
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 94.97
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 94.48
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 94.36
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 94.24
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 94.02
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 93.91
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 93.7
cd04123162 Rab21 Rab21 subfamily. The localization and function of 93.69
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 93.54
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 93.5
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 93.17
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 93.06
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 92.61
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 92.22
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 92.17
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 91.8
TIGR01394 609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 91.37
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 91.36
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 91.11
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 91.09
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 91.04
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 90.56
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 90.37
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 90.18
PRK00889175 adenylylsulfate kinase; Provisional 96.6
PRK09270230 frcK putative fructose transport system kinase; Reviewe 96.19
KOG2749415 consensus 95.94
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 95.67
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 94.59
PRK09112352 DNA polymerase III subunit delta'; Validated 94.52
pfam08419116 consensus 94.32
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope 94.0
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 93.64
PRK10875 607 recD exonuclease V subunit alpha; Provisional 93.5
PRK08939306 primosomal protein DnaI; Reviewed 93.24
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 92.94
KOG4658 889 consensus 92.56
PRK05564313 DNA polymerase III subunit delta'; Validated 91.95
PRK12377248 putative replication protein; Provisional 91.86
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 91.6
PRK12771 560 putative glutamate synthase (NADPH) small subunit; Prov 91.17
pfam07279218 DUF1442 Protein of unknown function (DUF1442). This fam 90.19
pfam00931285 NB-ARC NB-ARC domain. 95.22
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.09
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.04
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.69
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 94.68
PRK04220306 2-phosphoglycerate kinase; Provisional 94.2
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 94.04
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 93.88
PRK12339197 2-phosphoglycerate kinase; Provisional 92.86
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 92.34
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 91.93
PRK12337492 2-phosphoglycerate kinase; Provisional 91.83
pfam07755302 DUF1611 Protein of unknown function (DUF1611). This reg 94.89
COG1160444 Predicted GTPases [General function prediction only] 94.15
PRK00093438 engA GTP-binding protein EngA; Reviewed 93.38
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 92.31
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 93.72
PRK08691704 DNA polymerase III subunits gamma and tau; Validated 93.3
COG1160444 Predicted GTPases [General function prediction only] 92.18
PRK06872696 DNA polymerase III subunits gamma and tau; Provisional 91.86
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 90.39
KOG2968 1158 consensus 92.19
COG1493308 HprK Serine kinase of the HPr protein, regulates carboh 92.02
PRK10490 895 sensor protein KdpD; Provisional 91.62
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD; InterPro: IPR010224 Proper placement of the bacterial cell division site requires the site-specific inactivation of other potential division sites Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>pfam06564 YhjQ YhjQ protein Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein; InterPro: IPR005977 The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges Back     alignment and domain information
>KOG3022 consensus Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein; InterPro: IPR005971 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls Back     alignment and domain information
>pfam07015 VirC1 VirC1 protein Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X; InterPro: IPR010246 This entry represents the X subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase , Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR004484 This family describes cobyrinic acid a,c-diamide synthase, the cobB (cbiA in Salmonella) protein of cobalamin biosynthesis Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>pfam09140 MipZ ATPase MipZ Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information