255764485

255764485

hypothetical protein CLIBASIA_03065

GeneID in NCBI database:8209731Locus tag:CLIBASIA_03065
Protein GI in NCBI database:255764485Protein Accession:YP_003065139.2
Gene range:+(540742, 541473)Protein Length:243aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein; K02281 pilus assembly protein CpaD
SEED prediction:Flp pilus assembly protein CpaD
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED3 TM-Helix
HMMTOP4 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVTPPDAEQRDKSIQRYRQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccHHHccccHHccccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHEEEEcccccccccccEEEEEEEEEEccccccccccHHHccHHHcccccccccHHHHHHHHHHHccHHHHHcccccccccHHHHHHHHHHHcc
ccHHHEHHHHHccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEcccEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccEEEEEEEEcccccccccccHHcccccccccccccccHHHHHHHHHHHccHHHHccccccccccHHHHHHHHHHHcc
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGtsalayydegsdyrdrypilMRKVEqivdipllagrgeikypiHDTIRGFLEKYKNDSASVLFLLipsptvssaSIRRAVKDIRKIIIssgipvssiseriydadygmdvDTIRLSyfaskpsagkcgfwpedmlgnakgnrnwtnygcayqnnlaaqvvnpldlfsprmvtppdaeqrDKSIQRYRQ
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIpllagrgeikyPIHDTIRGFLEKYKNDSASVLFLLipsptvssasIRRAVKDIRKiiissgipvssiserIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRmvtppdaeqrdksiqryrq
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFlrtlmlgqlfflllfYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKiiissgipvssisERIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVTPPDAEQRDKSIQRYRQ
***EYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLA*********HDTIRGFLEKYKNDSASVLFLLIPS***********VKDIRKIIISSGIPVS****************TIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMV*****EQRDK*IQ*YR*
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVT****************
*MVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVTPPDAEQRDKSIQRYRQ
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVTPPDAEQRDKSIQRYRQ
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVTPPDAEQRDKSIQRYRQ
MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALAYYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGMDVDTIRLSYFASKPSAGKCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVTPPDAEQRDKSIQRYRQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target243 hypothetical protein CLIBASIA_03065 [Candidatus Liberib
315121890224 hypothetical protein CKC_00700 [Candidatus Liberibacter 1 1e-77
15963895226 hypothetical protein SMc04110 [Sinorhizobium meliloti 1 1 1e-36
307320427226 pilus (Caulobacter type) biogenesis lipoprotein CpaD [S 1 2e-36
222147181196 component of type IV pilus [Agrobacterium vitis S4] Len 1 5e-35
150398542242 pilus biogenesis lipoprotein CpaD [Sinorhizobium medica 1 5e-35
159184217193 components of type IV pilus [Agrobacterium tumefaciens 1 6e-35
227823972234 pilus assembly protein CpaD [Sinorhizobium fredii NGR23 1 3e-34
325291658252 components of type IV pilus [Agrobacterium sp. H13-3] L 1 1e-33
222084470235 pilus assembly protein [Agrobacterium radiobacter K84] 1 3e-32
304392383227 pilus assembly protein [Ahrensia sp. R2A130] Length = 2 1 3e-31
>gi|315121890|ref|YP_004062379.1| hypothetical protein CKC_00700 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 224 Back     alignment and organism information
 Score =  293 bits (750), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 188/243 (77%), Gaps = 23/243 (9%)

Query: 1   MMVEYMITILFGGVCFKGLANMRSLISCLKTIFWKNFFLRTLMLGQLFFLLLFYGTSALA 60
           MM + MI  +FGG+CFK L +               FFL      Q+ FLLLF G + LA
Sbjct: 1   MMRDIMIKEIFGGMCFKRLVS---------------FFLM-----QISFLLLFCGNNVLA 40

Query: 61  YYDEGSDYRDRYPILMRKVEQIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLL 120
                +DYRDRYPI+M+KVE+ +DIPLL+GRG++   ++DTI+GF+++YK +S SV+F+L
Sbjct: 41  ---NQNDYRDRYPIVMKKVEKSLDIPLLSGRGKLPSDMYDTIKGFIDRYKQNSTSVIFIL 97

Query: 121 IPSPTVSSASIRRAVKDIRKIIISSGIPVSSISERIYDADYGMDVDTIRLSYFASKPSAG 180
           IP+PT+SS +I+ A+K+IR+ IIS+GIP SS+SER YDADY +D+DTIRLSYFAS+PSAG
Sbjct: 98  IPTPTISSHAIQDALKNIRRFIISNGIPSSSLSERSYDADYELDIDTIRLSYFASRPSAG 157

Query: 181 KCGFWPEDMLGNAKGNRNWTNYGCAYQNNLAAQVVNPLDLFSPRMVTPPDAEQRDKSIQR 240
           KCGFWPED+LG++  N NW+NYGC+YQNNLAAQ+VNP+DLF+PR +TPPDA  RD+SI R
Sbjct: 158 KCGFWPEDILGSSLENSNWSNYGCSYQNNLAAQIVNPMDLFAPRSMTPPDAVHRDRSIHR 217

Query: 241 YRQ 243
           Y++
Sbjct: 218 YQE 220


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15963895|ref|NP_384248.1| hypothetical protein SMc04110 [Sinorhizobium meliloti 1021] Length = 226 Back     alignment and organism information
>gi|307320427|ref|ZP_07599844.1| pilus (Caulobacter type) biogenesis lipoprotein CpaD [Sinorhizobium meliloti AK83] Length = 226 Back     alignment and organism information
>gi|222147181|ref|YP_002548138.1| component of type IV pilus [Agrobacterium vitis S4] Length = 196 Back     alignment and organism information
>gi|150398542|ref|YP_001329009.1| pilus biogenesis lipoprotein CpaD [Sinorhizobium medicae WSM419] Length = 242 Back     alignment and organism information
>gi|159184217|ref|NP_353253.2| components of type IV pilus [Agrobacterium tumefaciens str. C58] Length = 193 Back     alignment and organism information
>gi|227823972|ref|YP_002827945.1| pilus assembly protein CpaD [Sinorhizobium fredii NGR234] Length = 234 Back     alignment and organism information
>gi|325291658|ref|YP_004277522.1| components of type IV pilus [Agrobacterium sp. H13-3] Length = 252 Back     alignment and organism information
>gi|222084470|ref|YP_002542999.1| pilus assembly protein [Agrobacterium radiobacter K84] Length = 235 Back     alignment and organism information
>gi|304392383|ref|ZP_07374324.1| pilus assembly protein [Ahrensia sp. R2A130] Length = 227 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target243 hypothetical protein CLIBASIA_03065 [Candidatus Liberib
pfam09476200 pfam09476, Pilus_CpaD, Pilus biogenesis CpaD protein (p 2e-37
TIGR02522198 TIGR02522, pilus_cpaD, pilus (Caulobacter type) biogene 2e-34
COG5461224 COG5461, COG5461, Type IV pili component [Cell motility 1e-39
>gnl|CDD|150221 pfam09476, Pilus_CpaD, Pilus biogenesis CpaD protein (pilus_cpaD) Back     alignment and domain information
>gnl|CDD|162903 TIGR02522, pilus_cpaD, pilus (Caulobacter type) biogenesis lipoprotein CpaD Back     alignment and domain information
>gnl|CDD|35020 COG5461, COG5461, Type IV pili component [Cell motility and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 243 hypothetical protein CLIBASIA_03065 [Candidatus Liberib
pfam09476200 Pilus_CpaD Pilus biogenesis CpaD protein (pilus_cpaD). 100.0
COG5461224 Type IV pili component [Cell motility and secretion] 100.0
TIGR02522211 pilus_cpaD pilus (Caulobacter type) biogenesis lipoprot 100.0
>pfam09476 Pilus_CpaD Pilus biogenesis CpaD protein (pilus_cpaD) Back     alignment and domain information
>COG5461 Type IV pili component [Cell motility and secretion] Back     alignment and domain information
>TIGR02522 pilus_cpaD pilus (Caulobacter type) biogenesis lipoprotein CpaD; InterPro: IPR013361 Proteins in this entry consist of a pilus biogenesis protein, CpaD, from Caulobacter, and homologues in other bacteria, including three in the root nodule bacterium Bradyrhizobium japonicum Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 hypothetical protein CLIBASIA_03065 [Candidatus Liberib
2hqs_H118 Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, t 93.65
2aiz_P134 Outer membrane protein P6; alpha-beta sandwich; HET: UD 93.64
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A Back     alignment and structure
Probab=93.65  E-value=0.39  Score=26.85  Aligned_cols=80  Identities=9%  Similarity=0.064  Sum_probs=62.0

Q ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEC---CCC--CCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCC
Q ss_conf             885156676889888899999999997418872999924---989--887899999999999999759882340661036
Q gi|255764485|r   84 DIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIP---SPT--VSSASIRRAVKDIRKIIISSGIPVSSISERIYD  158 (243)
Q Consensus        84 DIpVg~g~g~Lt~~qr~~V~gFa~~yrr~G~G~i~I~vP---sGS--~Na~AA~~~~~eIR~~L~~~GVp~~~I~v~~Y~  158 (243)
                      .|++..+.-.|++.....+..++..-.....-.|.|.-=   .|+  .|-.-+..=+..|+..|...||++..|.+..|-
T Consensus         7 ~VyF~~~s~~l~~~~~~~L~~ia~~L~~~p~~~i~I~GhtD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~rI~~~g~G   86 (118)
T 2hqs_H            7 IVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYG   86 (118)
T ss_dssp             EEECCTTCCCCCGGGHHHHHHHHHHHHHCTTCCEEEEECCCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGGEEEEECT
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC
T ss_conf             99940897607998999999999999778991999999728998765667799999999999999849980469999974


Q ss_pred             CCCCC
Q ss_conf             88854
Q gi|255764485|r  159 ADYGM  163 (243)
Q Consensus       159 a~~p~  163 (243)
                      ...|.
T Consensus        87 ~~~p~   91 (118)
T 2hqs_H           87 KEKPA   91 (118)
T ss_dssp             TSSCS
T ss_pred             CCCCC
T ss_conf             65777



>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 hypothetical protein CLIBASIA_03065 [Candidatus Liberib
d2aizp1134 Peptidoglycan-associated lipoprotein, PAL, periplasmic 94.03
d2hqsc1106 Peptidoglycan-associated lipoprotein, PAL, periplasmic 90.29
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: OmpA-like
family: OmpA-like
domain: Peptidoglycan-associated lipoprotein, PAL, periplasmic domain
species: Haemophilus influenzae [TaxId: 727]
Probab=94.03  E-value=0.16  Score=27.76  Aligned_cols=84  Identities=8%  Similarity=0.080  Sum_probs=64.5

Q ss_pred             EEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEC-----CCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             269885156676889888899999999997418872999924-----989887899999999999999759882340661
Q gi|255764485|r   81 QIVDIPLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIP-----SPTVSSASIRRAVKDIRKIIISSGIPVSSISER  155 (243)
Q Consensus        81 ~tlDIpVg~g~g~Lt~~qr~~V~gFa~~yrr~G~G~i~I~vP-----sGS~Na~AA~~~~~eIR~~L~~~GVp~~~I~v~  155 (243)
                      +...|++..+.-.|++.++..+..+++.-.....-.|.|.-=     +...|-.....=+..|+..|...||++..|.+.
T Consensus        28 ~~~~I~F~~~s~~L~~~~~~~L~~la~~l~~~~~~~i~I~GhtD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~ri~~~  107 (134)
T d2aizp1          28 RYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTV  107 (134)
T ss_dssp             TSCEEECCTTCCCCCHHHHHHHHHHHHHHHHSTTCCEEEEEECCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGGEEEE
T ss_pred             CCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             67818837998124988999999999999869996899960434332211101378999999998997718753455137


Q ss_pred             CCCCCCCCC
Q ss_conf             036888543
Q gi|255764485|r  156 IYDADYGMD  164 (243)
Q Consensus       156 ~Y~a~~p~~  164 (243)
                      .|-.+.|..
T Consensus       108 g~G~~~P~~  116 (134)
T d2aizp1         108 SYGEEKPAV  116 (134)
T ss_dssp             ECTTTSCSS
T ss_pred             ECCCCCCCC
T ss_conf             754337578



>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 hypothetical protein CLIBASIA_03065 [Candidatus Liberib
3khn_A_174 MOTB protein, putative; structural genomics, OMPA- 94.03
>3khn_A (A:) MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Back     alignment and structure
Probab=94.03  E-value=0.51  Score=27.08  Aligned_cols=95  Identities=6%  Similarity=-0.040  Sum_probs=76.1

Q ss_pred             CCCEEEEECCEEEE--E----ECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCC----------CCHHHHHHH
Q ss_conf             38577733772698--8----5156676889888899999999997418872999924989----------887899999
Q gi|255764485|r   71 RYPILMRKVEQIVD--I----PLLAGRGEIKYPIHDTIRGFLEKYKNDSASVLFLLIPSPT----------VSSASIRRA  134 (243)
Q Consensus        71 RHPIvi~Ea~~tlD--I----pVg~g~g~Lt~~qr~~V~gFa~~yrr~G~G~i~I~vPsGS----------~Na~AA~~~  134 (243)
                      .+++.+...++.+.  +    .+..|.-.|++..+..+..++.--.....-.|.|.-.+.+          .|......-
T Consensus        33 ~~~~~v~~~~~~~~i~~~~~~~F~~gs~~l~~~~~~~L~~ia~~l~~~~~~~i~I~GhtD~~g~~~~~~~~~n~~LS~~R  112 (174)
T 3khn_A           33 EGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLKDLFIRRREQNINIKGFTDDVQPSANARFKDNWEVSALR  112 (174)
T ss_dssp             TTTCEEEEETTEEEEEEEHHHHBCTTCCSBCTTHHHHHHHHHHHHHHTTTCEEEEEEECCSCCCCTTSSCSSHHHHHHHH
T ss_pred             CCCEEEEEECCEEEEEECCCCEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHH
T ss_conf             77569998399899994687324699740298899999999875403874299997403676665566432013688999


Q ss_pred             HHHHHHHHHHCCCCCCCEEEECCCCCCCCCC
Q ss_conf             9999999997598823406610368885436
Q gi|255764485|r  135 VKDIRKIIISSGIPVSSISERIYDADYGMDV  165 (243)
Q Consensus       135 ~~eIR~~L~~~GVp~~~I~v~~Y~a~~p~~a  165 (243)
                      ...|+..|...|+++..|.+..|-.+.|-..
T Consensus       113 A~~V~~~l~~~gi~~~ri~~~g~G~~~p~~~  143 (174)
T 3khn_A          113 SVNVLRYFLGAGIEPARLTATGLGELDPLFP  143 (174)
T ss_dssp             HHHHHHHHHHTTCCGGGEEEEEEETSSCSSC
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEEECCCCCCC
T ss_conf             9999999987147866679998424577799