254780727

254780727

putative pilus assembly protein

GeneID in NCBI database:8209732Locus tag:CLIBASIA_03070
Protein GI in NCBI database:254780727Protein Accession:YP_003065140.1
Gene range:+(539321, 540745)Protein Length:474aa
Gene description:putative pilus assembly protein
COG prediction:[U] Flp pilus assembly protein, secretin CpaC
KEGG prediction:putative pilus assembly protein; K02280 pilus assembly protein CpaC
SEED prediction:Type II/IV secretion system secretin RcpA/CpaC, associated with Flp pilus assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----
MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
cHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccccHHHccccccEEEEEcccEEEEEcccccEEEEEccccEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEEEEcccHHHHHHHHHHccccccEEEEEcccEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccEEEEEEEEEEEEcccccEEEEEEEEccccccccccccccccccccccccccEEccccccccHHHHHHHHHHcccEEEEEccEEEEEcccEEEEEEccEEEEEEEcccccEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEcccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEccccccccccccEEcccccHHHcccccccccEEEEEEEEEEEEEcccccccccccccccccHHHHHHHHccccccccccccccccccccccccEEEEEc
ccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEccccccEEEEEcccccEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEEEEcccHHHHHHHHHHHcccccEEEEEcccEEEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEccccEEEEEEEEEEEEHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccEEEEEHHcccccEEEEccccEEEEccccEEEEEcccEcEccccccccEEEEEEEEccEEEEEEEEEccccEEEEEEEEEEEEccccccccEEccEEEEEEcEEEEccccccEHHHHHccccHHHHHccccccccccEHHHHEccccccccccEEEEEEEccEEccccHHHcccccccccccccHHHHHcccHccccccccccccccccccccEEEEEc
MRYLQRTFFTMMSIFLfssnpsvaklppikeanaavinisdveigkgkkisigLNKVIILQVPvdvqdvlvsdptkadvvvhsprtmyLFGKNVGQANVILIGhdgkqmlnlDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLsqsgrnqyanssSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGfqhsitgsssgpsksfaadfggkfvseggdfsvkgvldrFSFETVLHALERATAIRTlaeptltaisgqsasftsggqhlyktvssstgatsvtthdygvvlhftptvlspgriglriqtevsepvigvnagdmpsyrvrkadttvelpsggtIVLAGLLKDDIQQLKEgipllskipilgalfrnsrfnreeTEIFiaatpflvkpvamrdlsrpddhysvedDAKAFFFNRvnkiygpkeasevegqnykGAIGFIYK
MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETflsqsgrnqyanssSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQhsitgsssgpsKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIqtevsepvigvnagdmpsyrVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGipllskipilGALFRNSRFNREETEifiaatpflvkpvAMRDLSRPDDHYSVEDDAKAFFFNRVNKIygpkeasevegqnykgaigfiyk
MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKviilqvpvdvqdvlvSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHsitgsssgpsksFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKtvssstgatsvttHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
******TFFTMMSIFLFSSNPSVAKLPP***********************IGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRR********VEMVSDTVVLHGMVRTIQDSQRAVELSETFL***********S*KKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDD*****EGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDL**P***YSVEDDAKAFFF**********************AIGFIYK
MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSI*********SFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
*RYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNK*************NYKGAIGFIYK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK
MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDIAHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSSSKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVSEGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSSSTGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTVELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVKPVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target474 putative pilus assembly protein [Candidatus Liberibacte
255764483135 hypothetical protein CLIBASIA_03125 [Candidatus Li 3e-05
>gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Back     alignment
 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 7/74 (9%)

Query: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVV-VHSPRTMYLFGKNVGQANVILIGHDGK 107
           +I I + + +ILQ  V  + V+V D    DV+ +   +T+ + GKN+G  N+I++GH   
Sbjct: 34  RIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGH--- 90

Query: 108 QMLNLDILIERDIA 121
              N DIL++ +IA
Sbjct: 91  ---NNDILLDTEIA 101

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target474 putative pilus assembly protein [Candidatus Liberibacte
315121891471 putative pilus assembly protein [Candidatus Liberibacte 1 0.0
241207157499 type II and III secretion system protein [Rhizobium leg 1 1e-116
116249981501 pilus assembly protein [Rhizobium leguminosarum bv. vic 1 1e-116
86355864498 pilus assembly secretion protein [Rhizobium etli CFN 42 1 1e-116
209551759499 type II and III secretion system protein [Rhizobium leg 1 1e-115
190889881499 pilus assembly secretion protein [Rhizobium etli CIAT 6 1 1e-114
222084469505 pilus assembly secretion protein [Agrobacterium radioba 1 1e-114
218516388436 pilus assembly secretion protein [Rhizobium etli 8C-3] 1 1e-113
218680971434 putative pilus assembly protein [Rhizobium etli CIAT 89 1 1e-112
325291659527 component of type IV pilus [Agrobacterium sp. H13-3] Le 1 1e-109
>gi|315121891|ref|YP_004062380.1| putative pilus assembly protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 471 Back     alignment and organism information
 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/474 (69%), Positives = 390/474 (82%), Gaps = 3/474 (0%)

Query: 1   MRYLQRTFFTMMSIFLFSSNPSVAKLPPIKEANAAVINISDVEIGKGKKISIGLNKVIIL 60
           M+  Q+T F +  IF+ SSN  +A+   +   NA+ I+I D  IG  KKI+IGL KV+IL
Sbjct: 1   MKNFQKTLFMLFVIFISSSNFLLAQSKLVDAKNASTIHIGDSAIGTSKKINIGLGKVVIL 60

Query: 61  QVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIERDI 120
            +P  VQDVLVSDPTKADVVVHS +T+Y+FGK+VGQANVILIGHD KQ+LN+DI IERDI
Sbjct: 61  HLPSRVQDVLVSDPTKADVVVHSSKTVYIFGKSVGQANVILIGHDEKQLLNIDIFIERDI 120

Query: 121 AHLEMTLRRFIADSNIRVEMVSDTVVLHGMVRTIQDSQRAVELSETFLSQSGRNQYANSS 180
            +LEMT RRF++ SNI VEM+SD +VLHG VRTIQDSQ AVELS  FLS    N Y  +S
Sbjct: 121 RNLEMTFRRFLSGSNIHVEMLSDNLVLHGEVRTIQDSQHAVELSNMFLSNERNNLYKTAS 180

Query: 181 SKKVMNLLNIAGEDQVTLKVTIAEVRRDILKQIGFQHSITGSSSGPSKSFAADFGGKFVS 240
             KV+NLLNI  EDQVTLKVTIAEVRRD+LKQIGFQH+I  SS GPSK    DF G    
Sbjct: 181 GSKVINLLNIGAEDQVTLKVTIAEVRRDVLKQIGFQHTI--SSGGPSKGKRIDFDGSLGG 238

Query: 241 EGGDFSVKGVLDRFSFETVLHALERATAIRTLAEPTLTAISGQSASFTSGGQHLYKTVSS 300
           +G DF++  +LDRF+F++VL+ALERATAIRTLAEPTLTAISGQ+A+F SGG  LY++V +
Sbjct: 239 QGADFAMTTILDRFTFKSVLNALERATAIRTLAEPTLTAISGQNATFRSGGTRLYRSVGA 298

Query: 301 STGATSVTTHDYGVVLHFTPTVLSPGRIGLRIQTEVSEPVIGVNAGDMPSYRVRKADTTV 360
           + G +++T HDYGVVL FTPTVLSPGRIGLRI+TEVSEPV+GV+    P YR+RKADTTV
Sbjct: 299 N-GTSTITPHDYGVVLTFTPTVLSPGRIGLRIETEVSEPVLGVSTTGEPEYRMRKADTTV 357

Query: 361 ELPSGGTIVLAGLLKDDIQQLKEGIPLLSKIPILGALFRNSRFNREETEIFIAATPFLVK 420
           ELPSGGTIVLAGLLKDDIQQ + G+PLLSKIPILGALFR++ F+REETEIFI+ATPFLVK
Sbjct: 358 ELPSGGTIVLAGLLKDDIQQKRGGVPLLSKIPILGALFRSNSFSREETEIFISATPFLVK 417

Query: 421 PVAMRDLSRPDDHYSVEDDAKAFFFNRVNKIYGPKEASEVEGQNYKGAIGFIYK 474
           PVAM +LSRPDD+Y +E+DAKAF FNRVNKIYGPKEA++  GQNYKGAIGFIYK
Sbjct: 418 PVAMNELSRPDDNYDIENDAKAFLFNRVNKIYGPKEAAQGNGQNYKGAIGFIYK 471


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241207157|ref|YP_002978253.1| type II and III secretion system protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 499 Back     alignment and organism information
>gi|116249981|ref|YP_765819.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841] Length = 501 Back     alignment and organism information
>gi|86355864|ref|YP_467756.1| pilus assembly secretion protein [Rhizobium etli CFN 42] Length = 498 Back     alignment and organism information
>gi|209551759|ref|YP_002283676.1| type II and III secretion system protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 499 Back     alignment and organism information
>gi|190889881|ref|YP_001976423.1| pilus assembly secretion protein [Rhizobium etli CIAT 652] Length = 499 Back     alignment and organism information
>gi|222084469|ref|YP_002542998.1| pilus assembly secretion protein [Agrobacterium radiobacter K84] Length = 505 Back     alignment and organism information
>gi|218516388|ref|ZP_03513228.1| pilus assembly secretion protein [Rhizobium etli 8C-3] Length = 436 Back     alignment and organism information
>gi|218680971|ref|ZP_03528868.1| putative pilus assembly protein [Rhizobium etli CIAT 894] Length = 434 Back     alignment and organism information
>gi|325291659|ref|YP_004277523.1| component of type IV pilus [Agrobacterium sp. H13-3] Length = 527 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target474 putative pilus assembly protein [Candidatus Liberibacte
pfam00263164 pfam00263, Secretin, Bacterial type II and III secretio 6e-35
PHA00019428 PHA00019, IV, phage assembly protein 3e-19
COG4796709 COG4796, HofQ, Type II secretory pathway, component Hof 1e-15
TIGR02515418 TIGR02515, IV_pilus_PilQ, type IV pilus secretin (or co 6e-15
PRK13568381 PRK13568, hofQ, putative outer membrane porin HofQ; Pro 1e-13
COG1450587 COG1450, PulD, Type II secretory pathway, component Pul 8e-28
TIGR02517594 TIGR02517, type_II_gspD, general secretion pathway prot 2e-26
TIGR02519290 TIGR02519, pilus_MshL, pilus (MSHA type) biogenesis pro 2e-19
PRK10560386 PRK10560, hofQ, outer membrane porin HofQ; Provisional 8e-18
TIGR02516462 TIGR02516, type_III_yscC, type III secretion outer memb 5e-12
PRK15346499 PRK15346, PRK15346, outer membrane secretin SsaC; Provi 3e-06
TIGR02520497 TIGR02520, pilus_B_mal_scr, type IVB pilus formation ou 0.001
COG4964455 COG4964, CpaC, Flp pilus assembly protein, secretin Cpa 2e-92
>gnl|CDD|144009 pfam00263, Secretin, Bacterial type II and III secretion system protein Back     alignment and domain information
>gnl|CDD|106878 PHA00019, IV, phage assembly protein Back     alignment and domain information
>gnl|CDD|34405 COG4796, HofQ, Type II secretory pathway, component HofQ [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162898 TIGR02515, IV_pilus_PilQ, type IV pilus secretin (or competence protein) PilQ Back     alignment and domain information
>gnl|CDD|184149 PRK13568, hofQ, putative outer membrane porin HofQ; Provisional Back     alignment and domain information
>gnl|CDD|31639 COG1450, PulD, Type II secretory pathway, component PulD [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162900 TIGR02517, type_II_gspD, general secretion pathway protein D Back     alignment and domain information
>gnl|CDD|162901 TIGR02519, pilus_MshL, pilus (MSHA type) biogenesis protein MshL Back     alignment and domain information
>gnl|CDD|182549 PRK10560, hofQ, outer membrane porin HofQ; Provisional Back     alignment and domain information
>gnl|CDD|162899 TIGR02516, type_III_yscC, type III secretion outer membrane pore, YscC/HrcC family Back     alignment and domain information
>gnl|CDD|185244 PRK15346, PRK15346, outer membrane secretin SsaC; Provisional Back     alignment and domain information
>gnl|CDD|162902 TIGR02520, pilus_B_mal_scr, type IVB pilus formation outer membrane protein, R64 PilN family Back     alignment and domain information
>gnl|CDD|34571 COG4964, CpaC, Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 474 putative pilus assembly protein [Candidatus Liberibacte
COG4964455 CpaC Flp pilus assembly protein, secretin CpaC [Intrace 100.0
TIGR02517697 type_II_gspD general secretion pathway protein D; Inter 100.0
COG1450587 PulD Type II secretory pathway, component PulD [Cell mo 100.0
TIGR02516508 type_III_yscC type III secretion outer membrane pore, Y 100.0
COG4796709 HofQ Type II secretory pathway, component HofQ [Intrace 100.0
COG4796 709 HofQ Type II secretory pathway, component HofQ [Intrace 98.62
TIGR02515464 IV_pilus_PilQ type IV pilus secretin PilQ; InterPro: IP 100.0
PRK10560386 hofQ outer membrane porin HofQ; Provisional 100.0
PRK13568385 hofQ putative outer membrane porin HofQ; Provisional 100.0
PHA00019428 phage assembly protein 100.0
TIGR02519311 pilus_MshL pilus (MSHA type) biogenesis protein MshL; I 100.0
pfam00263164 Secretin Bacterial type II and III secretion system pro 100.0
TIGR02520536 pilus_B_mal_scr type IVB pilus formation outer membrane 100.0
pfam0497264 BON Putative phospholipid-binding domain. This domain i 97.37
PRK11023191 hypothetical protein; Provisional 95.88
COG2823196 OsmY Predicted periplasmic or secreted lipoprotein [Gen 95.34
PRK10568203 periplasmic protein; Provisional 95.33
PRK11023191 hypothetical protein; Provisional 95.94
PRK10568203 periplasmic protein; Provisional 95.84
>COG4964 CpaC Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02517 type_II_gspD general secretion pathway protein D; InterPro: IPR013356 In Gram-negative bacteria, proteins that have first crossed the inner member by Sec-dependent protein transport can be exported across the outer membrane by type II secretion (also referred to as the main terminal branch of the general secretion pathway) Back     alignment and domain information
>COG1450 PulD Type II secretory pathway, component PulD [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02516 type_III_yscC type III secretion outer membrane pore, YscC/HrcC family; InterPro: IPR003522 Secretion of virulence factors in Gram-negative bacteria involves transportation of the protein across two membranes to reach the cell exterior Back     alignment and domain information
>COG4796 HofQ Type II secretory pathway, component HofQ [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4796 HofQ Type II secretory pathway, component HofQ [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02515 IV_pilus_PilQ type IV pilus secretin PilQ; InterPro: IPR013355 A number of proteins homologous to PilQ are involved in type IV pilus formation, competence for transformation, type III secretion, and type II secretion (also referred to as the main terminal branch of the general secretion pathway) Back     alignment and domain information
>PRK10560 hofQ outer membrane porin HofQ; Provisional Back     alignment and domain information
>PRK13568 hofQ putative outer membrane porin HofQ; Provisional Back     alignment and domain information
>PHA00019 phage assembly protein Back     alignment and domain information
>TIGR02519 pilus_MshL pilus (MSHA type) biogenesis protein MshL; InterPro: IPR013358 Proteins containing this region are predicted secretins, that is, outer membrane pore proteins associated with delivery of proteins from the periplasm to the outside of the cell Back     alignment and domain information
>pfam00263 Secretin Bacterial type II and III secretion system protein Back     alignment and domain information
>TIGR02520 pilus_B_mal_scr type IVB pilus formation outer membrane protein, R64 PilN family; InterPro: IPR013359 Several related protein families encode outer membrane pore proteins for type II secretion, type III secretion, and type IV pilus formation Back     alignment and domain information
>pfam04972 BON Putative phospholipid-binding domain Back     alignment and domain information
>PRK11023 hypothetical protein; Provisional Back     alignment and domain information
>COG2823 OsmY Predicted periplasmic or secreted lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10568 periplasmic protein; Provisional Back     alignment and domain information
>PRK11023 hypothetical protein; Provisional Back     alignment and domain information
>PRK10568 periplasmic protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target474 putative pilus assembly protein [Candidatus Liberibacte
1f1s_A 814 Hyaluronate lyase; the structure consists of three dist 92.04
>1f1s_A Hyaluronate lyase; the structure consists of three distinct structural domains: two beta domains at two terminals and one alpha domain in the middle of the sequence.; 2.10A {Streptococcus agalactiae} SCOP: a.102.3.2 b.1.18.2 b.24.1.1 b.30.5.2 PDB: 1i8q_A* 1lxm_A* Back     alignment and structure
Probab=92.04  E-value=0.45  Score=23.23  Aligned_cols=65  Identities=17%  Similarity=0.311  Sum_probs=54.2

Q ss_pred             CCEEEEEECCEEEEECCCCHHHEEECCCCEEEEEECCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             402799507259995377633078537343799971698799995267227999988999778999873045
Q gi|254780727|r   47 GKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER  118 (474)
Q Consensus        47 ~~~l~l~~g~s~~l~~~~~~~rV~V~dp~Vadv~v~s~~~i~i~gk~~G~T~l~v~~~~g~~~~~~~v~v~~  118 (474)
                      -+.+.+++++-.+++.++  ..--+.||+|+.+.     .-++++.++|.|++.+.+++|+.+..+.+.+..
T Consensus        12 ~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~-----~g~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~   76 (814)
T 1f1s_A           12 EKSVNTALNKNYVFNKAD--YQYTLTNPSLGKIV-----GGILYPNATGSTTVKISDKSGKIIKEVPLSVTA   76 (814)
T ss_dssp             CSCEEEETTSCEECSSTT--SEEEESSGGGEEEE-----TTEEEECSCEEEEEEEECTTCCEEEEEEEEEEC
T ss_pred             HHHEECCCCCEEEECCCC--EEEEECCCCHHEEE-----CCEEEECCCCEEEEEEECCCCCEEEEEEEEECC
T ss_conf             340423447656532664--26776386260121-----645871258807999985899789997636437




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target474 putative pilus assembly protein [Candidatus Liberibacte
d1f1sa278 Hyaluronate lyase precatalytic domain {Streptococcus ag 93.8
>d1f1sa2 b.1.18.2 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: E-set domains of sugar-utilizing enzymes
domain: Hyaluronate lyase precatalytic domain
species: Streptococcus agalactiae [TaxId: 1311]
Probab=93.80  E-value=0.12  Score=25.20  Aligned_cols=67  Identities=16%  Similarity=0.299  Sum_probs=54.4

Q ss_pred             CCCCEEEEEECCEEEEECCCCHHHEEECCCCEEEEEECCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             65402799507259995377633078537343799971698799995267227999988999778999873045
Q gi|254780727|r   45 GKGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER  118 (474)
Q Consensus        45 ~~~~~l~l~~g~s~~l~~~~~~~rV~V~dp~Vadv~v~s~~~i~i~gk~~G~T~l~v~~~~g~~~~~~~v~v~~  118 (474)
                      +-.+.+++++|+-.++...+  ....|-||.|+.+.    +. ++...+.|.|++.+.|.+|+.+..+-+.+.+
T Consensus        10 ~lE~~i~lpL~K~yvf~~aD--Y~Y~iens~i~~V~----nG-il~Pl~eG~T~vkVsdkdGk~vk~iPl~v~a   76 (78)
T d1f1sa2          10 QIEKSVNTALNKNYVFNKAD--YQYTLTNPSLGKIV----GG-ILYPNATGSTTVKISDKSGKIIKEVPLSVTA   76 (78)
T ss_dssp             CCCSCEEEETTSCEECSSTT--SEEEESSGGGEEEE----TT-EEEECSCEEEEEEEECTTCCEEEEEEEEEEC
T ss_pred             HHHHHHCCCCCCEEEEEECC--EEEEECCCCEEEEE----CC-EEEECCCCCEEEEEECCCCCEEEEEEEEEEE
T ss_conf             57776134456102765031--58896078624663----42-5777336845899863589699997248870



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target474 putative pilus assembly protein [Candidatus Liberibacte
1f1s_A_1-7878 Hyaluronate lyase; the structure consists of three 94.59
>1f1s_A (A:1-78) Hyaluronate lyase; the structure consists of three distinct structural domains: two beta domains at two terminals and one alpha domain in the middle of the sequence.; 2.10A {Streptococcus agalactiae} Back     alignment and structure
Probab=94.59  E-value=0.16  Score=26.72  Aligned_cols=66  Identities=17%  Similarity=0.295  Sum_probs=54.3

Q ss_pred             CCCEEEEEECCEEEEECCCCHHHEEECCCCEEEEEECCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             5402799507259995377633078537343799971698799995267227999988999778999873045
Q gi|254780727|r   46 KGKKISIGLNKVIILQVPVDVQDVLVSDPTKADVVVHSPRTMYLFGKNVGQANVILIGHDGKQMLNLDILIER  118 (474)
Q Consensus        46 ~~~~l~l~~g~s~~l~~~~~~~rV~V~dp~Vadv~v~s~~~i~i~gk~~G~T~l~v~~~~g~~~~~~~v~v~~  118 (474)
                      --..++++.|+-.++..+.  ...-|.|+.||.+.     .=.|...+.|.|++.+.+.+|+.+..+-+.|..
T Consensus        11 lE~~I~l~l~K~yv~~~~d--Y~Y~i~n~sia~ve-----nG~i~Plk~G~T~v~V~dk~Gk~i~~ipL~Vt~   76 (78)
T 1f1s_A           11 IEKSVNTALNKNYVFNKAD--YQYTLTNPSLGKIV-----GGILYPNATGSTTVKISDKSGKIIKEVPLSVTA   76 (78)
T ss_dssp             CCSCEEEETTSCEECSSTT--SEEEESSGGGEEEE-----TTEEEECSCEEEEEEEECTTCCEEEEEEEEEEC
T ss_pred             HHHHEECCCCCEEEECCCC--EEEEECCCCEEEEE-----CCEEEECCCCEEEEEEECCCCCEEEEEEEEECC
T ss_conf             3441323447656632674--27997387506775-----537861368807999984799689999768616