254780728

254780728

pilus assembly protein

GeneID in NCBI database:8209733Locus tag:CLIBASIA_03075
Protein GI in NCBI database:254780728Protein Accession:YP_003065141.1
Gene range:+(538530, 539321)Protein Length:263aa
Gene description:pilus assembly protein
COG prediction:[U] Flp pilus assembly protein CpaB
KEGG prediction:pilus assembly protein; K02279 pilus assembly protein CpaB
SEED prediction:Flp pilus assembly protein RcpC/CpaB
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGIS
cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccccccccHHHEEEEEccHHHcccccccccccccccccccccEEEEccccccccccccccccccccHHHccccccEEEEEEccHHHccccEEccccEEEEEEEccccccccEEEEEEcccEEEEEEccccccccccccEEEEEEEcHHHHHHHHHHHHccEEEEEEEccccccccccccccccccccccccEEEEEEEEEEEccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHccccccccEEEEEEcccccccccccHHHcEEEcccHHcccccccccccccccHHHccccEEEEEccccccccHHHccccccccHHHHcccccEEEEEEEccccccccEEccccEEEEEEEEcccccccEEEEEEccEEEEEEEcccccccccEEEEEEEEEEcHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEcccccEEEEEEEcEEEEccccccc
MKLTRLMGIVVSGVFALVAGIIAMRlvsphhvqteevitenPAKFINVLISkgdlavgmvvtpnilewvafpeenvfdgfiddvhqpnamqeLDGVLvrvpilkgdpirleklvdrgngglssllpkgkraatmDISISsavggmikpndhVDVVMVRSlserkptvTVVLSNIRVIAidhnidsdervlvgstatleLTPMQAKALVAAQSVAKLSLVLRSIadlnpsssedsdvwdvqeegkeiQIIKAGVIVNKDGEGIS
mkltrlmgIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGdpirleklvdrgngglssllpkgkraaTMDISIssavggmikpnDHVDVVMVRSlserkptvtvvLSNIRVIaidhnidsderVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIAdlnpsssedsdvwdVQEEgkeiqiikagvivnkdgegis
MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGIS
**LTRLMGIVVSGVFALVAGIIAMRLV******************INVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNG**S*LLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIA****************ATLELTPMQAKALVAAQSVAKLSLVLRSI****************************************
MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLN***********VQEEGKEIQIIKAGVIVNKDGEGIS
*KLTRLMGIVVSGVFALVAGIIAMRLVSPHH***********AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKD*****
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGIS
MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGIS
MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGGLSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAIDHNIDSDERVLVGSTATLELTPMQAKALVAAQSVAKLSLVLRSIADLNPSSSEDSDVWDVQEEGKEIQIIKAGVIVNKDGEGIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target263 pilus assembly protein [Candidatus Liberibacter asiatic
315121892267 pilus assembly protein [Candidatus Liberibacter solanac 1 6e-88
222084468270 pilus assembly protein [Agrobacterium radiobacter K84] 1 7e-46
325291660268 components of type IV pilus [Agrobacterium sp. H13-3] L 1 9e-45
227823970271 pilus assembly protein CpaB [Sinorhizobium fredii NGR23 1 1e-44
15887574268 components of type IV pilus [Agrobacterium tumefaciens 1 1e-44
15963893269 putative pilus assembly signal peptide protein [Sinorhi 1 2e-44
222147183269 component of type IV pilus [Agrobacterium vitis S4] Len 1 3e-43
150398540269 SAF domain-containing protein [Sinorhizobium medicae WS 1 9e-43
209551758271 Flp pilus assembly protein CpaB [Rhizobium leguminosaru 1 6e-42
190889880271 pilus assembly protein [Rhizobium etli CIAT 652] Length 1 2e-41
>gi|315121892|ref|YP_004062381.1| pilus assembly protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 267 Back     alignment and organism information
 Score =  328 bits (840), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 164/266 (61%), Positives = 213/266 (80%), Gaps = 3/266 (1%)

Query: 1   MKLTRLMGIVVSGVFALVAGIIAMRLVSPHHVQTEEVITENPAKFINVLISKGDLAVGMV 60
           MK TRLMG+VVSG+FAL+AGIIAMRLVS HH+Q EE++ +   +  NVL++K +L VGMV
Sbjct: 1   MKFTRLMGLVVSGLFALLAGIIAMRLVSHHHLQKEEIVAQPSIRLSNVLMAKSNLKVGMV 60

Query: 61  VTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGNGG 120
           +TP++LEWVAFP ENV  GF+DDV +PNA++EL G +VR+PILKGDPIR EKLVD G  G
Sbjct: 61  ITPDVLEWVAFPAENVVVGFVDDVSRPNAIEELKGSIVRIPILKGDPIRFEKLVDHGQHG 120

Query: 121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSNIRVIAID 180
           +SSLL KGKRA  +DIS+S+AVGG++KPNDHVDV+MVR + ERK    VVLSN+RV+AID
Sbjct: 121 VSSLLSKGKRAVALDISVSNAVGGLVKPNDHVDVLMVRLIGERKTKTDVVLSNVRVLAID 180

Query: 181 HNIDS--DERVLVGSTATLELTPMQAKALVAAQSVA-KLSLVLRSIADLNPSSSEDSDVW 237
             +D+  +   L+G+TATLELTPMQAK L+AAQ +A KL+LVLRSI+D + +  E +D  
Sbjct: 181 QTLDAEGEPNGLIGNTATLELTPMQAKTLLAAQQIASKLTLVLRSISDFHSTDLEIADFN 240

Query: 238 DVQEEGKEIQIIKAGVIVNKDGEGIS 263
             ++ G+ IQ+IK+G+I NKDGE +S
Sbjct: 241 LGEDGGRGIQVIKSGIISNKDGEEMS 266


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084468|ref|YP_002542997.1| pilus assembly protein [Agrobacterium radiobacter K84] Length = 270 Back     alignment and organism information
>gi|325291660|ref|YP_004277524.1| components of type IV pilus [Agrobacterium sp. H13-3] Length = 268 Back     alignment and organism information
>gi|227823970|ref|YP_002827943.1| pilus assembly protein CpaB [Sinorhizobium fredii NGR234] Length = 271 Back     alignment and organism information
>gi|15887574|ref|NP_353255.1| components of type IV pilus [Agrobacterium tumefaciens str. C58] Length = 268 Back     alignment and organism information
>gi|15963893|ref|NP_384246.1| putative pilus assembly signal peptide protein [Sinorhizobium meliloti 1021] Length = 269 Back     alignment and organism information
>gi|222147183|ref|YP_002548140.1| component of type IV pilus [Agrobacterium vitis S4] Length = 269 Back     alignment and organism information
>gi|150398540|ref|YP_001329007.1| SAF domain-containing protein [Sinorhizobium medicae WSM419] Length = 269 Back     alignment and organism information
>gi|209551758|ref|YP_002283675.1| Flp pilus assembly protein CpaB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 271 Back     alignment and organism information
>gi|190889880|ref|YP_001976422.1| pilus assembly protein [Rhizobium etli CIAT 652] Length = 271 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target263 pilus assembly protein [Candidatus Liberibacter asiatic
TIGR03177261 TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB 4e-39
COG3745276 COG3745, CpaB, Flp pilus assembly protein CpaB [Intrace 4e-39
>gnl|CDD|163174 TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB Back     alignment and domain information
>gnl|CDD|33540 COG3745, CpaB, Flp pilus assembly protein CpaB [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 263 pilus assembly protein [Candidatus Liberibacter asiatic
TIGR03177261 pilus_cpaB Flp pilus assembly protein CpaB. Members of 100.0
COG3745276 CpaB Flp pilus assembly protein CpaB [Intracellular tra 100.0
PRK07018236 flgA flagellar basal body P-ring biosynthesis protein F 98.83
PRK12617214 flgA flagellar basal body P-ring biosynthesis protein F 98.81
smart0085864 SAF This domain family includes a range of different pr 98.65
PRK06804272 flgA flagellar basal body P-ring biosynthesis protein F 98.64
pfam0866663 SAF SAF domain. This domain family includes a range of 98.6
TIGR03170122 flgA_cterm flagella basal body P-ring formation protein 98.53
PRK12618138 flgA flagellar basal body P-ring biosynthesis protein F 98.53
COG1261220 FlgA Flagellar basal body P-ring biosynthesis protein [ 98.39
PRK08515229 flgA flagellar basal body P-ring biosynthesis protein F 97.77
TIGR03586327 PseI pseudaminic acid synthase. 96.86
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This family is 96.4
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesis, ou 96.07
PRK12786338 flgA flagellar basal body P-ring biosynthesis protein F 98.69
PRK06005161 flgA flagellar basal body P-ring biosynthesis protein F 98.13
PRK11556415 multidrug efflux system subunit MdtA; Provisional 95.01
PRK07021159 fliL flagellar basal body-associated protein FliL; Revi 92.5
PRK09859 385 multidrug efflux system protein MdtE; Provisional 90.25
>TIGR03177 pilus_cpaB Flp pilus assembly protein CpaB Back     alignment and domain information
>COG3745 CpaB Flp pilus assembly protein CpaB [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07018 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK12617 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>smart00858 SAF This domain family includes a range of different proteins Back     alignment and domain information
>PRK06804 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>pfam08666 SAF SAF domain Back     alignment and domain information
>TIGR03170 flgA_cterm flagella basal body P-ring formation protein FlgA Back     alignment and domain information
>PRK12618 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>COG1261 FlgA Flagellar basal body P-ring biosynthesis protein [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08515 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12786 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK06005 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target263 pilus assembly protein [Candidatus Liberibacter asiatic
3frn_A278 Flagellar protein FLGA; structural genomics, periplasmi 0.003
>3frn_A Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Length = 278 Back     alignment and structure
 Score = 37.6 bits (87), Expect = 0.003
 Identities = 21/151 (13%), Positives = 49/151 (32%), Gaps = 15/151 (9%)

Query: 33  QTEEVITENPAKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQE 92
            T   +     K  NV++ K ++ VG V+    +         ++     D      + E
Sbjct: 130 DTYVTLNMLLRKERNVVVLKRNINVGDVIKEEDVRLEKRNVFEIYGEPFFD------VSE 183

Query: 93  LDGVLVRVPILKGDPIRLEKLVD--RGNGGLSSLLPKGKRAATMDISISSAVGGMIKPND 150
           + G + R  + +G  +  + + D      G          +  +   +     G +    
Sbjct: 184 VVGKISRRYLKEGTVLTADMVKDPPDVVKGQVVPAYVDMGSIKVTTFVEVLENGYL---- 239

Query: 151 HVDVVMVRSLSERKPTVTVVLSN--IRVIAI 179
             + V   ++  RK     V     +R++ +
Sbjct: 240 -GETVRAMNVESRKYVFGRVERGPVLRILEV 269


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target263 pilus assembly protein [Candidatus Liberibacter asiatic
3frn_A278 Flagellar protein FLGA; structural genomics, periplasmi 99.35
1ops_A64 Type III AFP, type III antifreeze protein; ICE crystal 98.06
1msi_A70 Type III antifreeze protein isoform HPLC 12; multigene 97.99
1wvo_A79 Sialic acid synthase; antifreeze protein like domain, N 97.99
1c89_A134 RD3, antifreeze protein type III; thermal hysteresis pr 97.82
1ucs_A64 Antifreeze peptide RD1; small beta barrel, pretzel fold 97.76
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; NEUB 97.07
3g8r_A350 Probable spore coat polysaccharide biosynthesis protein 97.06
1vli_A385 Spore coat polysaccharide biosynthesis protein SPSE; 26 96.68
3k3s_A105 Altronate hydrolase; structural genomics, PSI-2, protei 91.12
>3frn_A Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Back     alignment and structure
Probab=99.35  E-value=4.2e-12  Score=88.32  Aligned_cols=126  Identities=17%  Similarity=0.169  Sum_probs=94.4

Q ss_pred             CCEEEEEEECCCCCCCCEECHHHEEEEECCHHHCCCHHCCCCCCCCCCHHCCCCEEECCCCCCCCCCHHHCCCCCC--CC
Q ss_conf             8704899972636889662753413155251337920000211245400003504420227887125555001467--63
Q gi|254780728|r   43 AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDRGN--GG  120 (263)
Q Consensus        43 ~~~v~V~va~~di~~G~~It~~dl~~~~~p~~~~p~~a~~~~~~~~~~~~~~G~~~~~~i~~G~~i~~~~l~~~~~--~~  120 (263)
                      ....+|+||+++|++|+.|+++|++++++|.+.+|++++++      .+++.|+.++++|.+|++|+.++|..+..  .+
T Consensus       140 r~~~~VvVa~r~I~~G~~It~~Dl~~~~~~~~~~~~~~~~~------~~~viGk~a~r~i~~G~~i~~~~l~~~~~V~~G  213 (278)
T 3frn_A          140 RKERNVVVLKRNINVGDVIKEEDVRLEKRNVFEIYGEPFFD------VSEVVGKISRRYLKEGTVLTADMVKDPPDVVKG  213 (278)
T ss_dssp             ECEEEEEEESSCBCTTCBCCTTTEEEEEEEGGGCSSCBCSC------HHHHTTCEESSCBCTTCBCBGGGEECCCSBCTT
T ss_pred             EEEEEEEEECCCCCCCCEECHHHHCCEEEECCCCCCCCCCC------HHHHCCEEECCCCCCCCCCCHHHCCCCCCCCCC
T ss_conf             99657999944429999967777012375315689754279------789589287035689994659983677514799


Q ss_pred             CEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEEECCCCCCCEEEEEECC--CEEEEE
Q ss_conf             00212798279999716010345621789889999950688876221451159--789996
Q gi|254780728|r  121 LSSLLPKGKRAATMDISISSAVGGMIKPNDHVDVVMVRSLSERKPTVTVVLSN--IRVIAI  179 (263)
Q Consensus       121 ls~~l~~g~ravsi~v~~~~~v~g~i~pGd~VDV~~~~~~~~~~~~~~~il~~--v~Vlav  179 (263)
                      -...+.-+...++++.+....-.|  ..||.|+|...   +.+....-.+..+  |+|+.+
T Consensus       214 ~~V~i~~~~g~i~i~~~g~Al~~G--~~Gd~I~V~N~---~S~k~i~g~V~~~g~V~Vi~~  269 (278)
T 3frn_A          214 QVVPAYVDMGSIKVTTFVEVLENG--YLGETVRAMNV---ESRKYVFGRVERGPVLRILEV  269 (278)
T ss_dssp             CEEEEEC-------CEEEEESSCB--CTTCEEEEEC-----CCCEEEEEEETTTEEEECC-
T ss_pred             CEEEEEEECCCEEEEEEEEECCCC--CCCCEEEEEEC---CCCCEEEEEEECCCEEEEEEE
T ss_conf             889999605759999978998788--98988999988---999989999956996999994



>1ops_A Type III AFP, type III antifreeze protein; ICE crystal growth inhibition, pretzel fold, glycoprotein; 2.00A {Macrozoarces americanus} SCOP: b.85.1.1 Back     alignment and structure
>1msi_A Type III antifreeze protein isoform HPLC 12; multigene family, thermal hysteresis; 1.25A {Macrozoarces americanus} SCOP: b.85.1.1 Back     alignment and structure
>1wvo_A Sialic acid synthase; antifreeze protein like domain, N-acetylneuraminic acid phosphate synthase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1c89_A RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} SCOP: b.85.1.1 b.85.1.1 PDB: 1c8a_A 3nla_A 3rdn_A Back     alignment and structure
>1ucs_A Antifreeze peptide RD1; small beta barrel, pretzel fold, antifreeze protein; 0.62A {Lycodichthys dearborni} SCOP: b.85.1.1 PDB: 9ame_A 1ame_A 1kde_A 1kdf_A 1gzi_A 1hg7_A 1b7i_A 2spg_A 1jab_A 1b7j_A 2msj_A 1ekl_A 4ame_A 7ame_A 2ame_A 1msj_A 1b7k_A 6ame_A 9msi_A 2jia_A ... Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transferase; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis protein E; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SPSE; 2636322, structural genomics, JCSG, protein structure initiative, BSU37870, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3k3s_A Altronate hydrolase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 2.15A {Shigella flexneri 2a str} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target263 pilus assembly protein [Candidatus Liberibacter asiatic
d1opsa_64 Type III antifreeze protein, AFP III {Ocean pout (Macro 97.97
d2zdra168 Capsule biosynthesis protein SiaC, C-terminal domain {N 97.56
d1vlia172 Spore coat polysaccharide biosynthesis protein SpsE, C- 97.11
d1ucsa_64 Type III antifreeze protein, AFP III {Antarctic eel pou 97.04
>d1opsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]} Back     information, alignment and structure
class: All beta proteins
fold: beta-clip
superfamily: AFP III-like domain
family: AFP III-like domain
domain: Type III antifreeze protein, AFP III
species: Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]
Probab=97.97  E-value=4.1e-06  Score=51.63  Aligned_cols=59  Identities=15%  Similarity=0.207  Sum_probs=48.7

Q ss_pred             EEEECCCCCCCCEECHHHEEEEECCHHHCCCHHCCCCCCCCCCHHCCCCEEECCCCCCCCCCHHHCCC
Q ss_conf             99972636889662753413155251337920000211245400003504420227887125555001
Q gi|254780728|r   48 VLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVD  115 (263)
Q Consensus        48 V~va~~di~~G~~It~~dl~~~~~p~~~~p~~a~~~~~~~~~~~~~~G~~~~~~i~~G~~i~~~~l~~  115 (263)
                      =+||++||++|+.||.+|+..+.-...-+|+..+         +.+.|+.++.+|.+|++|..+++-.
T Consensus         3 SiVA~~dI~~G~~lt~~~l~~Krp~p~GI~p~~~---------~~iIGKk~kkdi~~d~~L~~d~ik~   61 (64)
T d1opsa_           3 SVVATQLIPMNTALTPAMMEGKVTNPIGIPFAEM---------SQLVGKQVNTPVAKGQTLMPNMVKT   61 (64)
T ss_dssp             EEEESSCBCTTCBCCGGGEEEECCSSCCSBGGGG---------GGTTTCBBSSCBCTTCBCCGGGBTT
T ss_pred             CEEECCCCCCCCCCCHHHEEEEECCCCCCCHHHH---------HHHCCHHHHCCCCCCCCCCHHHHHC
T ss_conf             6786773289889257885787167887098899---------9974857523306988518999412



>d2zdra1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vlia1 b.85.1.1 (A:297-368) Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ucsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Lycodichthys dearborni), RD1 isoform [TaxId: 8201]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target263 pilus assembly protein [Candidatus Liberibacter asiatic
3frn_A_1-207207 Flagellar protein FLGA; structural genomics, perip 99.01
1wvo_A_79 Sialic acid synthase; antifreeze protein like doma 98.13
1msi_A_70 Type III antifreeze protein isoform HPLC 12; multi 98.04
2wqp_A_277-34973 Polysialic acid capsule biosynthesis protein SIAC; 98.01
1ops_A_64 Type III AFP, type III antifreeze protein; ICE cry 97.97
1ucs_A_64 Antifreeze peptide RD1; small beta barrel, pretzel 97.93
1c89_A_65-13470 RD3, antifreeze protein type III; thermal hysteres 97.83
1c89_A_1-6464 RD3, antifreeze protein type III; thermal hysteres 97.82
1vli_A_301-38585 Spore coat polysaccharide biosynthesis protein SPS 97.79
3k3s_A_105 Altronate hydrolase; structural genomics, PSI-2, p 92.18
3g8r_A_280-35071 Probable spore coat polysaccharide biosynthesis pr 91.16
>3frn_A (A:1-207) Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Back     alignment and structure
Probab=99.01  E-value=5.1e-10  Score=76.94  Aligned_cols=68  Identities=21%  Similarity=0.218  Sum_probs=62.8

Q ss_pred             CCEEEEEEECCCCCCCCEECHHHEEEEECCHHHCCCHHCCCCCCCCCCHHCCCCEEECCCCCCCCCCHHHCCCC
Q ss_conf             87048999726368896627534131552513379200002112454000035044202278871255550014
Q gi|254780728|r   43 AKFINVLISKGDLAVGMVVTPNILEWVAFPEENVFDGFIDDVHQPNAMQELDGVLVRVPILKGDPIRLEKLVDR  116 (263)
Q Consensus        43 ~~~v~V~va~~di~~G~~It~~dl~~~~~p~~~~p~~a~~~~~~~~~~~~~~G~~~~~~i~~G~~i~~~~l~~~  116 (263)
                      ..+.+|+|++|+|++|+.|+++|+++++++.+.++.+++++.      ++++|+.++++|.+|++|+.++|..|
T Consensus       140 ~~~~~VvVa~r~l~rG~~I~~~Di~~~~~~~~~l~~~~~~d~------~~~vG~~~~r~l~~Gq~i~~~~l~~P  207 (207)
T 3frn_A          140 RKERNVVVLKRNINVGDVIKEEDVRLEKRNVFEIYGEPFFDV------SEVVGKISRRYLKEGTVLTADMVKDP  207 (207)
T ss_dssp             ECEEEEEEESSCBCTTCBCCTTTEEEEEEEGGGCSSCBCSCH------HHHTTCEESSCBCTTCBCBGGGEECC
T ss_pred             EEEEEEEEECCCCCCCCEECHHHHCCEEEECCCCCCCCCCCH------HHHCCEEECCCCCCCCCCCHHHCCCC
T ss_conf             996579999444299999677770123753156897542797------89589287035689994659983677



>1wvo_A (A:) Sialic acid synthase; antifreeze protein like domain, N-acetylneuraminic acid phosphate synthase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1msi_A (A:) Type III antifreeze protein isoform HPLC 12; multigene family, thermal hysteresis; 1.25A {Macrozoarces americanus} Back     alignment and structure
>2wqp_A (A:277-349) Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transferase; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1ops_A (A:) Type III AFP, type III antifreeze protein; ICE crystal growth inhibition, pretzel fold, glycoprotein; 2.00A {Macrozoarces americanus} Back     alignment and structure
>1ucs_A (A:) Antifreeze peptide RD1; small beta barrel, pretzel fold, antifreeze protein; 0.62A {Lycodichthys dearborni} Back     alignment and structure
>1c89_A (A:65-134) RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} Back     alignment and structure
>1c89_A (A:1-64) RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} Back     alignment and structure
>1vli_A (A:301-385) Spore coat polysaccharide biosynthesis protein SPSE; 2636322, structural genomics, JCSG, protein structure initiative, BSU37870, PSI; 2.38A {Bacillus subtilis} Back     alignment and structure
>3k3s_A (A:) Altronate hydrolase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 2.15A {Shigella flexneri 2a str} Back     alignment and structure
>3g8r_A (A:280-350) Probable spore coat polysaccharide biosynthesis protein E; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure