254780729

254780729

peptidase A24A prepilin type IV

GeneID in NCBI database:8209734Locus tag:CLIBASIA_03080
Protein GI in NCBI database:254780729Protein Accession:YP_003065142.1
Gene range:+(537888, 538418)Protein Length:176aa
Gene description:peptidase A24A prepilin type IV
COG prediction:[N] [O] [U] Type II secretory pathway, prepilin signal peptidase PulO and related peptidases
KEGG prediction:peptidase A24A prepilin type IV; K02278 prepilin peptidase CpaA [EC:3.4.23.43]
SEED prediction:Type IV prepilin peptidase TadV/CpaA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Widespread colonization island
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM4 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHcc
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFafnimgggdvkLLTSTAvwfgwtpsfLSFLFFVAILGGILSVFILTVRMITnhipifgmfvpksflmknkipYGIAISmgglisypdsYLFKVALMGLSA
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVfiicfcffafNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA
****KMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLS*
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA
**ESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLS*
iiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooo
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA
MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIALHLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFILTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target176 peptidase A24A prepilin type IV [Candidatus Liberibacte
315121893178 peptidase A24A prepilin type IV [Candidatus Liberibacte 1 4e-57
150398539170 peptidase A24A prepilin type IV [Sinorhizobium medicae 1 1e-37
15887575170 components of type IV pilus, prepilin peptidase [Agroba 1 3e-36
209551757170 peptidase A24A prepilin type IV [Rhizobium leguminosaru 1 6e-36
222084467170 prepilin peptidase protein [Agrobacterium radiobacter K 1 4e-35
241207155170 peptidase A24A prepilin type IV [Rhizobium leguminosaru 1 1e-34
222147184172 component of type IV pilus prepilin peptidase protein [ 1 2e-32
116249979170 pilus assembly protein [Rhizobium leguminosarum bv. vic 1 1e-31
325291661170 components of type IV pilus, prepilin peptidase [Agroba 1 4e-31
190889879170 prepilin peptidase [Rhizobium etli CIAT 652] Length = 1 1 7e-30
>gi|315121893|ref|YP_004062382.1| peptidase A24A prepilin type IV [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 178 Back     alignment and organism information
 Score =  224 bits (571), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 144/176 (81%)

Query: 1   MKESKMVFSAVFLIPPFCLVFAALSDLFSAMIPNRVSIVMLGSFLLTAFLLGMDYELIAL 60
           MKE KMVFS +FL+ PFCL+ A LSDLFS MIPNR+S+V+LGSFLL A  +G+ YE IAL
Sbjct: 1   MKEDKMVFSVIFLVLPFCLISAGLSDLFSTMIPNRISVVLLGSFLLIAPFVGLGYEEIAL 60

Query: 61  HLLVGLIVFIICFCFFAFNIMGGGDVKLLTSTAVWFGWTPSFLSFLFFVAILGGILSVFI 120
           H+LVGL VFI CF FF+ NIMGGGD KLLT+ ++WFGW  S L FLF+VAI GGIL++ +
Sbjct: 61  HVLVGLFVFIACFFFFSVNIMGGGDAKLLTTASLWFGWNISLLYFLFYVAIFGGILALVV 120

Query: 121 LTVRMITNHIPIFGMFVPKSFLMKNKIPYGIAISMGGLISYPDSYLFKVALMGLSA 176
           L +R IT +IP+   FVP+SF MKNKIPYG+AIS+GGL+SYPDS+LFK+AL G+S 
Sbjct: 121 LLIREITRYIPLLDKFVPRSFHMKNKIPYGVAISIGGLVSYPDSHLFKIALEGIST 176


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150398539|ref|YP_001329006.1| peptidase A24A prepilin type IV [Sinorhizobium medicae WSM419] Length = 170 Back     alignment and organism information
>gi|15887575|ref|NP_353256.1| components of type IV pilus, prepilin peptidase [Agrobacterium tumefaciens str. C58] Length = 170 Back     alignment and organism information
>gi|209551757|ref|YP_002283674.1| peptidase A24A prepilin type IV [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 170 Back     alignment and organism information
>gi|222084467|ref|YP_002542996.1| prepilin peptidase protein [Agrobacterium radiobacter K84] Length = 170 Back     alignment and organism information
>gi|241207155|ref|YP_002978251.1| peptidase A24A prepilin type IV [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 170 Back     alignment and organism information
>gi|222147184|ref|YP_002548141.1| component of type IV pilus prepilin peptidase protein [Agrobacterium vitis S4] Length = 172 Back     alignment and organism information
>gi|116249979|ref|YP_765817.1| pilus assembly protein [Rhizobium leguminosarum bv. viciae 3841] Length = 170 Back     alignment and organism information
>gi|325291661|ref|YP_004277525.1| components of type IV pilus, prepilin peptidase [Agrobacterium sp. H13-3] Length = 170 Back     alignment and organism information
>gi|190889879|ref|YP_001976421.1| prepilin peptidase [Rhizobium etli CIAT 652] Length = 170 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target176 peptidase A24A prepilin type IV [Candidatus Liberibacte
pfam01478103 pfam01478, Peptidase_A24, Type IV leader peptidase fami 2e-05
COG4960168 COG4960, CpaA, Flp pilus assembly protein, protease Cpa 1e-19
>gnl|CDD|144901 pfam01478, Peptidase_A24, Type IV leader peptidase family Back     alignment and domain information
>gnl|CDD|34567 COG4960, CpaA, Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 176 peptidase A24A prepilin type IV [Candidatus Liberibacte
COG4960168 CpaA Flp pilus assembly protein, protease CpaA [Posttra 99.97
COG1989254 PulO Type II secretory pathway, prepilin signal peptida 99.68
pfam01478103 Peptidase_A24 Type IV leader peptidase family. Peptidas 99.8
>COG4960 CpaA Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1989 PulO Type II secretory pathway, prepilin signal peptidase PulO and related peptidases [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam01478 Peptidase_A24 Type IV leader peptidase family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00