254780734
Flp/Fap pilin component
GeneID in NCBI database: | 8209739 | Locus tag: | CLIBASIA_03105 |
Protein GI in NCBI database: | 254780734 | Protein Accession: | YP_003065147.1 |
Gene range: | +(535208, 535396) | Protein Length: | 62aa |
Gene description: | Flp/Fap pilin component | ||
COG prediction: | [U] Flp pilus assembly protein, pilin Flp | ||
KEGG prediction: | Flp/Fap pilin component; K02651 pilus assembly protein Flp/PilA | ||
SEED prediction: | hypothetical protein | ||
Pathway involved in KEGG: | not defined | ||
Subsystem involved in SEED: | - none - | ||
sequence | sequence profile |
Prediction of Local Sequence Properties
Source | Summary | Result |
---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
Identity | Alignment graph | Length | Definition | E-value | |
Target | 62 | Flp/Fap pilin component [Candidatus Liberibacter asiati | |||
254780733 | 56 | hypothetical protein CLIBASIA_03100 [Candidatus Li | 2e-19 | ||
254780732 | 58 | hypothetical protein CLIBASIA_03095 [Candidatus Li | 8e-19 | ||
254780730 | 120 | hypothetical protein CLIBASIA_03085 [Candidatus Li | 4e-13 | ||
254780736 | 60 | hypothetical protein CLIBASIA_03115 [Candidatus Li | 7e-06 | ||
254780735 | 75 | hypothetical protein CLIBASIA_03110 [Candidatus Li | 0.020 |
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 | Back alignment |
---|
Score = 85.1 bits (209), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 43/54 (79%), Positives = 47/54 (87%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54 MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I Sbjct: 1 MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54 |
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 | Back alignment |
---|
Score = 83.2 bits (204), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 42/50 (84%), Positives = 42/50 (84%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50 MKMHIVKNFLQDESGATAIEYGLL SLIAV II SVTTLGGKL F I Sbjct: 1 MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADI 50 |
>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 | Back alignment |
---|
Score = 63.9 bits (154), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 28/50 (56%), Positives = 41/50 (82%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50 MKM+I+K L++ SGATAIEYGLL SL++V II++V+TLG ++K ++ I Sbjct: 1 MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTI 50 |
>gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 | Back alignment |
---|
Score = 40.0 bits (92), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 28/45 (62%), Positives = 34/45 (75%) Query: 4 HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48 + + L+DESGA AIEYG+LV+LIAV II +VT LGG LK FE Sbjct: 3 NCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFE 47 |
>gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 | Back alignment |
---|
Score = 28.5 bits (62), Expect = 0.020, Method: Compositional matrix adjust. Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Query: 20 EYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI--VTTSPA 60 EYG++ +LIAV II +VT LGG LK AFE + + TT P Sbjct: 6 EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPP 48 |
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
Identity | Alignment graph | Length | Definition | Round | E-value |
Target | 62 | Flp/Fap pilin component [Candidatus Liberibacter asiati | |||
254780733 | 56 | hypothetical protein CLIBASIA_03100 [Candidatus Liberib | 1 | 3e-15 | |
254780732 | 58 | hypothetical protein CLIBASIA_03095 [Candidatus Liberib | 1 | 1e-14 | |
315121897 | 64 | hypothetical protein CKC_00735 [Candidatus Liberibacter | 1 | 2e-11 | |
167648155 | 61 | Flp/Fap pilin component [Caulobacter sp. K31] Length = | 1 | 4e-10 | |
16127178 | 59 | pilus subunit protein PilA [Caulobacter crescentus CB15 | 1 | 3e-09 | |
295690802 | 59 | Flp/Fap pilin component [Caulobacter segnis ATCC 21756] | 1 | 6e-09 | |
254780730 | 120 | hypothetical protein CLIBASIA_03085 [Candidatus Liberib | 1 | 7e-09 | |
83859354 | 69 | hypothetical protein OA2633_13155 [Oceanicaulis alexand | 1 | 8e-09 | |
220923697 | 54 | Flp/Fap pilin protein [Methylobacterium nodulans ORS 20 | 1 | 4e-08 | |
33593020 | 58 | hypothetical protein BP1991 [Bordetella pertussis Toham | 1 | 4e-08 |
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 | Back alignment and organism information |
---|
Score = 85.1 bits (209), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 43/54 (79%), Positives = 47/54 (87%) Query: 1 MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54 MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I Sbjct: 1 MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54 |
Species: Candidatus Liberibacter asiaticus Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 | Back alignment and organism information |
---|
>gi|315121897|ref|YP_004062386.1| hypothetical protein CKC_00735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 | Back alignment and organism information |
---|
>gi|167648155|ref|YP_001685818.1| Flp/Fap pilin component [Caulobacter sp. K31] Length = 61 | Back alignment and organism information |
---|
>gi|16127178|ref|NP_421742.1| pilus subunit protein PilA [Caulobacter crescentus CB15] Length = 59 | Back alignment and organism information |
---|
>gi|295690802|ref|YP_003594495.1| Flp/Fap pilin component [Caulobacter segnis ATCC 21756] Length = 59 | Back alignment and organism information |
---|
>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 | Back alignment and organism information |
---|
>gi|83859354|ref|ZP_00952875.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii HTCC2633] Length = 69 | Back alignment and organism information |
---|
>gi|220923697|ref|YP_002498999.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060] Length = 54 | Back alignment and organism information |
---|
>gi|33593020|ref|NP_880664.1| hypothetical protein BP1991 [Bordetella pertussis Tohama I] Length = 58 | Back alignment and organism information |
---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLASTagainst CDD database part II
Identity | Alignment graph | Length | Definition | E-value |
Target | 62 | Flp/Fap pilin component [Candidatus Liberibacter asiati | ||
COG3847 | 58 | COG3847, Flp, Flp pilus assembly protein, pilin Flp [In | 3e-08 | |
pfam04964 | 47 | pfam04964, Flp_Fap, Flp/Fap pilin component | 1e-08 |
>gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] | Back alignment and domain information |
---|
>gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component | Back alignment and domain information |
---|
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
Identity | Alignment graph | Length | Definition | Probability |
Target | 62 | Flp/Fap pilin component [Candidatus Liberibacter asiati | ||
COG3847 | 58 | Flp Flp pilus assembly protein, pilin Flp [Intracellula | 99.79 | |
pfam04964 | 47 | Flp_Fap Flp/Fap pilin component. | 99.73 | |
COG4961 | 185 | TadG Flp pilus assembly protein TadG [Intracellular tra | 97.24 |
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] | Back alignment and domain information |
---|
>pfam04964 Flp_Fap Flp/Fap pilin component | Back alignment and domain information |
---|
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] | Back alignment and domain information |
---|
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
No homologous structure with e-value below 0.005
Homologous Structures in PDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Homologous Structures in PDB70 Database Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 90.00
Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch
Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 90.00
Homologous Domains in MMDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against MMDB70 database
No hit with e-value below 0.005
Homologous Domains in MMDB70 Database Detected by HHsearch
Original result of HHsearch against MMDB70 database
No hit with probability higher than 90.00