254780734

254780734

Flp/Fap pilin component

GeneID in NCBI database:8209739Locus tag:CLIBASIA_03105
Protein GI in NCBI database:254780734Protein Accession:YP_003065147.1
Gene range:+(535208, 535396)Protein Length:62aa
Gene description:Flp/Fap pilin component
COG prediction:[U] Flp pilus assembly protein, pilin Flp
KEGG prediction:Flp/Fap pilin component; K02651 pilus assembly protein Flp/PilA
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--
MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS
cHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
ccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHccccccccc
MKMHIVKnflqdesgaTAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS
MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS
MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS
****IVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA*********
MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI********
*KMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKA*********
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS
MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS
MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAIVTTSPAAS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target62 Flp/Fap pilin component [Candidatus Liberibacter asiati
25478073356 hypothetical protein CLIBASIA_03100 [Candidatus Li 2e-19
25478073258 hypothetical protein CLIBASIA_03095 [Candidatus Li 8e-19
254780730120 hypothetical protein CLIBASIA_03085 [Candidatus Li 4e-13
25478073660 hypothetical protein CLIBASIA_03115 [Candidatus Li 7e-06
25478073575 hypothetical protein CLIBASIA_03110 [Candidatus Li 0.020
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Back     alignment
 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 47/54 (87%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I
Sbjct: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54

>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Back     alignment
 Score = 83.2 bits (204), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 42/50 (84%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          MKMHIVKNFLQDESGATAIEYGLL SLIAV II SVTTLGGKL   F  I
Sbjct: 1  MKMHIVKNFLQDESGATAIEYGLLASLIAVAIIASVTTLGGKLTAVFADI 50

>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment
 Score = 63.9 bits (154), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 41/50 (82%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50
          MKM+I+K  L++ SGATAIEYGLL SL++V II++V+TLG ++K  ++ I
Sbjct: 1  MKMNIIKKILKNGSGATAIEYGLLASLVSVAIISAVSTLGDRMKGVYQTI 50

>gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Back     alignment
 Score = 40.0 bits (92), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (75%)

Query: 4  HIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFE 48
          + +   L+DESGA AIEYG+LV+LIAV II +VT LGG LK  FE
Sbjct: 3  NCMNKLLKDESGAAAIEYGMLVALIAVAIIAAVTMLGGSLKGTFE 47

>gi|254780735|ref|YP_003065148.1| hypothetical protein CLIBASIA_03110 [Candidatus Liberibacter asiaticus str. psy62] Length = 75 Back     alignment
 Score = 28.5 bits (62), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 2/43 (4%)

Query: 20 EYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI--VTTSPA 60
          EYG++ +LIAV II +VT LGG LK AFE +   +   TT P 
Sbjct: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPP 48

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target62 Flp/Fap pilin component [Candidatus Liberibacter asiati
25478073356 hypothetical protein CLIBASIA_03100 [Candidatus Liberib 1 3e-15
25478073258 hypothetical protein CLIBASIA_03095 [Candidatus Liberib 1 1e-14
31512189764 hypothetical protein CKC_00735 [Candidatus Liberibacter 1 2e-11
16764815561 Flp/Fap pilin component [Caulobacter sp. K31] Length = 1 4e-10
1612717859 pilus subunit protein PilA [Caulobacter crescentus CB15 1 3e-09
29569080259 Flp/Fap pilin component [Caulobacter segnis ATCC 21756] 1 6e-09
254780730120 hypothetical protein CLIBASIA_03085 [Candidatus Liberib 1 7e-09
8385935469 hypothetical protein OA2633_13155 [Oceanicaulis alexand 1 8e-09
22092369754 Flp/Fap pilin protein [Methylobacterium nodulans ORS 20 1 4e-08
3359302058 hypothetical protein BP1991 [Bordetella pertussis Toham 1 4e-08
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Back     alignment and organism information
 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 47/54 (87%)

Query: 1  MKMHIVKNFLQDESGATAIEYGLLVSLIAVVIITSVTTLGGKLKKAFEAIDKAI 54
          MKM+IVK+FL+DESGATAIEYGLL SLIAV II SVTTLGGKL K FE I+K I
Sbjct: 1  MKMNIVKDFLKDESGATAIEYGLLASLIAVAIIASVTTLGGKLSKVFEDIEKGI 54


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Back     alignment and organism information
>gi|315121897|ref|YP_004062386.1| hypothetical protein CKC_00735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Back     alignment and organism information
>gi|167648155|ref|YP_001685818.1| Flp/Fap pilin component [Caulobacter sp. K31] Length = 61 Back     alignment and organism information
>gi|16127178|ref|NP_421742.1| pilus subunit protein PilA [Caulobacter crescentus CB15] Length = 59 Back     alignment and organism information
>gi|295690802|ref|YP_003594495.1| Flp/Fap pilin component [Caulobacter segnis ATCC 21756] Length = 59 Back     alignment and organism information
>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment and organism information
>gi|83859354|ref|ZP_00952875.1| hypothetical protein OA2633_13155 [Oceanicaulis alexandrii HTCC2633] Length = 69 Back     alignment and organism information
>gi|220923697|ref|YP_002498999.1| Flp/Fap pilin protein [Methylobacterium nodulans ORS 2060] Length = 54 Back     alignment and organism information
>gi|33593020|ref|NP_880664.1| hypothetical protein BP1991 [Bordetella pertussis Tohama I] Length = 58 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target62 Flp/Fap pilin component [Candidatus Liberibacter asiati
COG384758 COG3847, Flp, Flp pilus assembly protein, pilin Flp [In 3e-08
pfam0496447 pfam04964, Flp_Fap, Flp/Fap pilin component 1e-08
>gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 62 Flp/Fap pilin component [Candidatus Liberibacter asiati
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 99.79
pfam0496447 Flp_Fap Flp/Fap pilin component. 99.73
COG4961 185 TadG Flp pilus assembly protein TadG [Intracellular tra 97.24
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>pfam04964 Flp_Fap Flp/Fap pilin component Back     alignment and domain information
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00