254780735

254780735

hypothetical protein CLIBASIA_03110

GeneID in NCBI database:8209740Locus tag:CLIBASIA_03110
Protein GI in NCBI database:254780735Protein Accession:YP_003065148.1
Gene range:+(534217, 534444)Protein Length:75aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70-----
MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEMPPRSRYNTGIGYGRT
cHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc
MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANqmshqttkppvtrpvtptstempprsryntgigygrt
MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANqmshqttkppvtrpvtptstempprsryntgigygrt
MQRLYEYGMMaaliavaiiaavTKLGGSLKGAFEEVANQMSHQttkppvtrpvtptstEMPPRSRYNTGIGYGRT
**RLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVAN***************************YNT*IGYG**
MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVA************************PRSRYNTGIGYGRT
*QRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQM**************************N********
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEMPPRSRYNTGIGYGRT
MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEMPPRSRYNTGIGYGRT
MQRLYEYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKPPVTRPVTPTSTEMPPRSRYNTGIGYGRT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target75 hypothetical protein CLIBASIA_03110 [Candidatus Liberib
25478073258 hypothetical protein CLIBASIA_03095 [Candidatus Li 2e-07
25478073356 hypothetical protein CLIBASIA_03100 [Candidatus Li 3e-07
254780730120 hypothetical protein CLIBASIA_03085 [Candidatus Li 4e-07
25478073462 Flp/Fap pilin component [Candidatus Liberibacter a 1e-06
25478073660 hypothetical protein CLIBASIA_03115 [Candidatus Li 8e-05
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Back     alignment
 Score = 45.4 bits (106), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 30/36 (83%)

Query: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMS 41
          EYG++A+LIAVAIIA+VT LGG L   F +++++++
Sbjct: 20 EYGLLASLIAVAIIASVTTLGGKLTAVFADISSKLN 55

>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Back     alignment
 Score = 45.1 bits (105), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 26/31 (83%)

Query: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEV 36
          EYG++A+LIAVAIIA+VT LGG L   FE++
Sbjct: 20 EYGLLASLIAVAIIASVTTLGGKLSKVFEDI 50

>gi|254780730|ref|YP_003065143.1| hypothetical protein CLIBASIA_03085 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Back     alignment
 Score = 44.3 bits (103), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKP--PVTRPVTPTSTE 59
          EYG++A+L++VAII+AV+ LG  +KG ++ ++ ++      P  P + P+ P S+ 
Sbjct: 20 EYGLLASLVSVAIISAVSTLGDRMKGVYQTISTELDKGDVPPTKPGSVPMQPESSN 75

>gi|254780734|ref|YP_003065147.1| Flp/Fap pilin component [Candidatus Liberibacter asiaticus str. psy62] Length = 62 Back     alignment
 Score = 42.7 bits (99), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%)

Query: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEV 36
          EYG++ +LIAV II +VT LGG LK AFE +
Sbjct: 20 EYGLLVSLIAVVIITSVTTLGGKLKKAFEAI 50

>gi|254780736|ref|YP_003065149.1| hypothetical protein CLIBASIA_03115 [Candidatus Liberibacter asiaticus str. psy62] Length = 60 Back     alignment
 Score = 36.6 bits (83), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%)

Query: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSH 42
          EYGM+ ALIAVAIIAAVT LGGSLKG FEE AN++S+
Sbjct: 19 EYGMLVALIAVAIIAAVTMLGGSLKGTFEEAANRISN 55

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target75 hypothetical protein CLIBASIA_03110 [Candidatus Liberib
22091338870 Flp/Fap pilin component [Arthrobacter chlorophenolicus 1 3e-04
14826101367 Flp/Fap pilin component [Acidiphilium cryptum JF-5] Len 1 0.002
22119777772 Flp/Fap pilin component [Burkholderia multivorans CGD2M 1 0.002
25478073258 hypothetical protein CLIBASIA_03095 [Candidatus Liberib 1 0.003
22121314373 Flp/Fap pilin component [Burkholderia multivorans CGD1] 1 0.003
31110763665 Flp/Fap pilin component family protein [Achromobacter x 1 0.003
25478073356 hypothetical protein CLIBASIA_03100 [Candidatus Liberib 1 0.004
30238176055 Flp/Fap pilin component [Brevundimonas subvibrioides AT 1 0.004
3359696458 hypothetical protein BPP2371 [Bordetella parapertussis 2 2e-05
3359302058 hypothetical protein BP1991 [Bordetella pertussis Toham 2 3e-05
>gi|220913388|ref|YP_002488697.1| Flp/Fap pilin component [Arthrobacter chlorophenolicus A6] Length = 70 Back     alignment and organism information
 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 6  EYGMMAALIAVAIIAAVTKLGGSLKGAFEEVANQMSHQTTKP 47
          EYG+M  LIAV II AV+ LGG+L G F+ +  +++ +TT P
Sbjct: 29 EYGIMVGLIAVVIIVAVSTLGGTLDGFFDSINTELAPKTTTP 70


Species: Arthrobacter chlorophenolicus
Genus: Arthrobacter
Family: Micrococcaceae
Order: Actinomycetales
Class: Actinobacteria (class)
Phylum: Actinobacteria
Superkingdom: Bacteria
>gi|148261013|ref|YP_001235140.1| Flp/Fap pilin component [Acidiphilium cryptum JF-5] Length = 67 Back     alignment and organism information
>gi|221197777|ref|ZP_03570823.1| Flp/Fap pilin component [Burkholderia multivorans CGD2M] Length = 72 Back     alignment and organism information
>gi|254780732|ref|YP_003065145.1| hypothetical protein CLIBASIA_03095 [Candidatus Liberibacter asiaticus str. psy62] Length = 58 Back     alignment and organism information
>gi|221213143|ref|ZP_03586119.1| Flp/Fap pilin component [Burkholderia multivorans CGD1] Length = 73 Back     alignment and organism information
>gi|311107636|ref|YP_003980489.1| Flp/Fap pilin component family protein [Achromobacter xylosoxidans A8] Length = 65 Back     alignment and organism information
>gi|254780733|ref|YP_003065146.1| hypothetical protein CLIBASIA_03100 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Back     alignment and organism information
>gi|302381760|ref|YP_003817583.1| Flp/Fap pilin component [Brevundimonas subvibrioides ATCC 15264] Length = 55 Back     alignment and organism information
>gi|33596964|ref|NP_884607.1| hypothetical protein BPP2371 [Bordetella parapertussis 12822] Length = 58 Back     alignment and organism information
>gi|33593020|ref|NP_880664.1| hypothetical protein BP1991 [Bordetella pertussis Tohama I] Length = 58 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target75 hypothetical protein CLIBASIA_03110 [Candidatus Liberib
COG384758 COG3847, Flp, Flp pilus assembly protein, pilin Flp [In 1e-04
pfam0496447 pfam04964, Flp_Fap, Flp/Fap pilin component 2e-06
>gnl|CDD|33638 COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|113726 pfam04964, Flp_Fap, Flp/Fap pilin component Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 75 hypothetical protein CLIBASIA_03110 [Candidatus Liberib
pfam0496447 Flp_Fap Flp/Fap pilin component. 99.24
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 99.02
>pfam04964 Flp_Fap Flp/Fap pilin component Back     alignment and domain information
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00