254780737

254780737

hypothetical protein CLIBASIA_03120

GeneID in NCBI database:8209742Locus tag:CLIBASIA_03120
Protein GI in NCBI database:254780737Protein Accession:YP_003065150.1
Gene range:-(532696, 532878)Protein Length:60aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60
MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS
ccHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccHHccEEEHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccEEEEccHHHHHHHHHHHHcccc
MARTQIALALSFFMITHsyyafsqdeikknnptlekkpiVLMKHEIQEKKTLAAFTSFAS
MARTQIALALSFFMITHSYYAFsqdeikknnptlekKPIVLMKHEIQEKKTLaaftsfas
MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS
***TQIALALSFFMITHSYYAF****************IVLMKHEIQEKKTLAAFTSFA*
MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS
*ARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooo
MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target60 hypothetical protein CLIBASIA_03120 [Candidatus Liberib
315121901 206 hypothetical protein CKC_00755 [Candidatus Liberibacter 1 7e-07
>gi|315121901|ref|YP_004062390.1| hypothetical protein CKC_00755 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 206 Back     alignment and organism information
 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 1  MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEK-KPIVLMKHEIQEKKTL 52
          MAR QIAL LS  MI +SY AFS DE  KN+P+  + +PI+ +KH  +EKK +
Sbjct: 1  MARIQIALVLSTIMIAYSYPAFSNDETNKNDPSANRQRPILPLKHAKEEKKPI 53


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00