255764483

255764483

hypothetical protein CLIBASIA_03125

GeneID in NCBI database:8209743Locus tag:CLIBASIA_03125
Protein GI in NCBI database:255764483Protein Accession:YP_003065151.2
Gene range:-(532299, 532706)Protein Length:135aa
Gene description:hypothetical protein
COG prediction:[U] Flp pilus assembly protein, secretin CpaC
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPRCLPSSPPVR
ccHHHHHHHHHHHHHccccccHHHHHccccccEEEEEEcccEEEEEccccHHHEEEccHHHEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEEEEEEccccEEEEEEcccEEEEEEEccccccccccc
cccHHHHHHHHHHHHHcccccHHcccccccccccEEEEcccEEEEcccccccEEEEccHHHHHEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEEEEEcccccEEEEEEccEEEEEEccccccccccccc
mhrkrqreiknetvrkkgipttasqktpednsnRIRIAVGQSLIlqfdvlpkqvivgddKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIAtfaneqstvrvytpgtlsflsctprclpssppvr
mhrkrqreiknetvrkkgipttasqktpednsnRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKtvvitgknlgstniIVLGHNNDILLDTEIATFANEQSTVRVYTPGTlsflsctprclpssppvr
MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPRCLPSSPPVR
************************************IAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPR*********
**********NETVRKKGIPT*********NSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPR*********
*HRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPRCLPS*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPRCLPSSPPVR
MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPRCLPSSPPVR
MHRKRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSCTPRCLPSSPPVR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target135 hypothetical protein CLIBASIA_03125 [Candidatus Liberib
254780727 474 putative pilus assembly protein [Candidatus Liberi 5e-06
>gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Back     alignment
 Score = 41.6 bits (96), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 7/74 (9%)

Query: 34  RIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGH--- 90
           +I I + + +ILQ  V  + V+V D    DV+ +   +T+ + GKN+G  N+I++GH   
Sbjct: 49  KISIGLNKVIILQVPVDVQDVLVSDPTKADVV-VHSPRTMYLFGKNVGQANVILIGHDGK 107

Query: 91  ---NNDILLDTEIA 101
              N DIL++ +IA
Sbjct: 108 QMLNLDILIERDIA 121

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target135 hypothetical protein CLIBASIA_03125 [Candidatus Liberib
315121901206 hypothetical protein CKC_00755 [Candidatus Liberibacter 1 1e-35
114705461156 hypothetical protein FP2506_10991 [Fulvimarina pelagi H 1 3e-13
90419761157 possible pilus assembly protein (CpaC) [Aurantimonas ma 1 4e-10
218506995151 pilus subunit transmembrane protein [Rhizobium etli Bra 1 6e-10
15963890138 hypothetical protein SMc04115 [Sinorhizobium meliloti 1 1 6e-10
222147187159 pilus subunit transmembrane protein [Agrobacterium viti 1 7e-10
327194698136 pilus subunit transmembrane protein [Rhizobium etli CNP 1 8e-10
150398537140 hypothetical protein Smed_3348 [Sinorhizobium medicae W 1 9e-10
218461610124 pilus subunit transmembrane protein [Rhizobium etli Kim 1 1e-09
190889877136 pilus subunit transmembrane protein [Rhizobium etli CIA 1 1e-09
>gi|315121901|ref|YP_004062390.1| hypothetical protein CKC_00755 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 206 Back     alignment and organism information
 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 96/128 (75%), Gaps = 1/128 (0%)

Query: 4   KRQREIKNETVRKKGIPTTASQKTPEDNSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVD 63
           KR+ EI+    + +   T + Q T  D   RIRIA+GQS++L+FD LP +VI+G+D+I D
Sbjct: 77  KRRTEIQKNATKPRTTNTPSPQPTTND-EKRIRIAIGQSIVLKFDSLPSEVIIGNDQITD 135

Query: 64  VLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQSTVRVYTPGTLSFLSC 123
           VLALEKEK++VITGK  G TNIIVLG  N +LL+T+I +F NE  TVRVYTP  LSFLSC
Sbjct: 136 VLALEKEKSIVITGKKSGLTNIIVLGAGNKVLLETDILSFPNEHDTVRVYTPEKLSFLSC 195

Query: 124 TPRCLPSS 131
           TPRCLP+S
Sbjct: 196 TPRCLPNS 203


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|114705461|ref|ZP_01438369.1| hypothetical protein FP2506_10991 [Fulvimarina pelagi HTCC2506] Length = 156 Back     alignment and organism information
>gi|90419761|ref|ZP_01227670.1| possible pilus assembly protein (CpaC) [Aurantimonas manganoxydans SI85-9A1] Length = 157 Back     alignment and organism information
>gi|218506995|ref|ZP_03504873.1| pilus subunit transmembrane protein [Rhizobium etli Brasil 5] Length = 151 Back     alignment and organism information
>gi|15963890|ref|NP_384243.1| hypothetical protein SMc04115 [Sinorhizobium meliloti 1021] Length = 138 Back     alignment and organism information
>gi|222147187|ref|YP_002548144.1| pilus subunit transmembrane protein [Agrobacterium vitis S4] Length = 159 Back     alignment and organism information
>gi|327194698|gb|EGE61544.1| pilus subunit transmembrane protein [Rhizobium etli CNPAF512] Length = 136 Back     alignment and organism information
>gi|150398537|ref|YP_001329004.1| hypothetical protein Smed_3348 [Sinorhizobium medicae WSM419] Length = 140 Back     alignment and organism information
>gi|218461610|ref|ZP_03501701.1| pilus subunit transmembrane protein [Rhizobium etli Kim 5] Length = 124 Back     alignment and organism information
>gi|190889877|ref|YP_001976419.1| pilus subunit transmembrane protein [Rhizobium etli CIAT 652] Length = 136 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 135 hypothetical protein CLIBASIA_03125 [Candidatus Liberib
COG4964 455 CpaC Flp pilus assembly protein, secretin CpaC [Intrace 99.47
>COG4964 CpaC Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target135 hypothetical protein CLIBASIA_03125 [Candidatus Liberib
1f1s_A 814 Hyaluronate lyase; the structure consists of three dist 94.2
2l04_A91 Major tail protein V; bacteriophage lambda, phage tail, 93.8
>1f1s_A Hyaluronate lyase; the structure consists of three distinct structural domains: two beta domains at two terminals and one alpha domain in the middle of the sequence.; 2.10A {Streptococcus agalactiae} SCOP: a.102.3.2 b.1.18.2 b.24.1.1 b.30.5.2 PDB: 1i8q_A* 1lxm_A* Back     alignment and structure
Probab=94.20  E-value=0.19  Score=27.53  Aligned_cols=69  Identities=9%  Similarity=0.203  Sum_probs=56.6

Q ss_pred             CCEEEEEECCEEEEECCCCCEEEEECCCCEEEEEEECCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEEEEECCCC
Q ss_conf             62799960828999847665027832844178998179988999960577089999879998899889999727987
Q gi|255764483|r   32 SNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFANEQS  108 (135)
Q Consensus        32 s~~i~v~vgks~il~l~~p~~~V~VgnP~IADv~~l~~~~~i~v~GK~~G~Tnliv~d~~g~~i~~~~i~V~~~~~~  108 (135)
                      ..+|.++.+|--++..+.-.-  .+.||+|+.+.   +   -+|++.+.|.|.+++.+.+|+.+...-+.|++++..
T Consensus        12 ~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~---~---g~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (814)
T 1f1s_A           12 EKSVNTALNKNYVFNKADYQY--TLTNPSLGKIV---G---GILYPNATGSTTVKISDKSGKIIKEVPLSVTASTED   80 (814)
T ss_dssp             CSCEEEETTSCEECSSTTSEE--EESSGGGEEEE---T---TEEEECSCEEEEEEEECTTCCEEEEEEEEEECCCCS
T ss_pred             HHHEECCCCCEEEECCCCEEE--EECCCCHHEEE---C---CEEEECCCCEEEEEEECCCCCEEEEEEEEECCCCHH
T ss_conf             340423447656532664267--76386260121---6---458712588079999858997899976364377735



>2l04_A Major tail protein V; bacteriophage lambda, phage tail, GPV, IG-like domain, viral; NMR {Enterobacteria phage lambda} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target135 hypothetical protein CLIBASIA_03125 [Candidatus Liberib
d1f1sa278 Hyaluronate lyase precatalytic domain {Streptococcus ag 94.37
>d1f1sa2 b.1.18.2 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: E-set domains of sugar-utilizing enzymes
domain: Hyaluronate lyase precatalytic domain
species: Streptococcus agalactiae [TaxId: 1311]
Probab=94.37  E-value=0.15  Score=26.79  Aligned_cols=67  Identities=9%  Similarity=0.196  Sum_probs=54.3

Q ss_pred             CCCEEEEEECCEEEEECCCCCEEEEECCCCEEEEEEECCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEEEEEC
Q ss_conf             762799960828999847665027832844178998179988999960577089999879998899889999727
Q gi|255764483|r   31 NSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFAN  105 (135)
Q Consensus        31 ~s~~i~v~vgks~il~l~~p~~~V~VgnP~IADv~~l~~~~~i~v~GK~~G~Tnliv~d~~g~~i~~~~i~V~~~  105 (135)
                      -..+|+++.||--++....=-.  .|-||+||.+.   + .  ++.-.+.|+|++.+.|.+|+.+...-+.|.+.
T Consensus        11 lE~~i~lpL~K~yvf~~aDY~Y--~iens~i~~V~---n-G--il~Pl~eG~T~vkVsdkdGk~vk~iPl~v~as   77 (78)
T d1f1sa2          11 IEKSVNTALNKNYVFNKADYQY--TLTNPSLGKIV---G-G--ILYPNATGSTTVKISDKSGKIIKEVPLSVTAS   77 (78)
T ss_dssp             CCSCEEEETTSCEECSSTTSEE--EESSGGGEEEE---T-T--EEEECSCEEEEEEEECTTCCEEEEEEEEEECC
T ss_pred             HHHHHCCCCCCEEEEEECCEEE--EECCCCEEEEE---C-C--EEEECCCCCEEEEEECCCCCEEEEEEEEEEEC
T ss_conf             7776134456102765031588--96078624663---4-2--57773368458998635896999972488707



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target135 hypothetical protein CLIBASIA_03125 [Candidatus Liberib
1f1s_A_1-7878 Hyaluronate lyase; the structure consists of three 94.6
>1f1s_A (A:1-78) Hyaluronate lyase; the structure consists of three distinct structural domains: two beta domains at two terminals and one alpha domain in the middle of the sequence.; 2.10A {Streptococcus agalactiae} Back     alignment and structure
Probab=94.60  E-value=0.33  Score=27.11  Aligned_cols=67  Identities=10%  Similarity=0.216  Sum_probs=54.7

Q ss_pred             CCCEEEEEECCEEEEECCCCCEEEEECCCCEEEEEEECCCCEEEEEECCCCEEEEEEECCCCCEEEEEEEEEEEC
Q ss_conf             762799960828999847665027832844178998179988999960577089999879998899889999727
Q gi|255764483|r   31 NSNRIRIAVGQSLILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDILLDTEIATFAN  105 (135)
Q Consensus        31 ~s~~i~v~vgks~il~l~~p~~~V~VgnP~IADv~~l~~~~~i~v~GK~~G~Tnliv~d~~g~~i~~~~i~V~~~  105 (135)
                      -.++|.++.||--++..+  =-.--|.|+.||-+.   + .  +|...+.|.|+|.|+|.+|+.|...-+.|.+.
T Consensus        11 lE~~I~l~l~K~yv~~~~--dY~Y~i~n~sia~ve---n-G--~i~Plk~G~T~v~V~dk~Gk~i~~ipL~Vt~s   77 (78)
T 1f1s_A           11 IEKSVNTALNKNYVFNKA--DYQYTLTNPSLGKIV---G-G--ILYPNATGSTTVKISDKSGKIIKEVPLSVTAS   77 (78)
T ss_dssp             CCSCEEEETTSCEECSST--TSEEEESSGGGEEEE---T-T--EEEECSCEEEEEEEECTTCCEEEEEEEEEECC
T ss_pred             HHHHEECCCCCEEEECCC--CEEEEECCCCEEEEE---C-C--EEEECCCCEEEEEEECCCCCEEEEEEEEECCC
T ss_conf             344132344765663267--427997387506775---5-3--78613688079999847996899997686166