254780739

254780739

hypothetical protein CLIBASIA_03130

GeneID in NCBI database:8209744Locus tag:CLIBASIA_03130
Protein GI in NCBI database:254780739Protein Accession:YP_003065152.1
Gene range:+(532065, 532259)Protein Length:64aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein; K09791 hypothetical protein
SEED prediction:protein of unknown function DUF343
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60----
MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG
cccccccccHHHHHHEEccccccEEEEcccccEEEcccccccccccccEEEEcHHHcEEccccc
cccccHHccHHHHHHHccccccccccccHHHcHHHcccccccccccccccEEcHHHHccccccc
mretifnidpQLLEILVcpltkgnltLISEGTELLSkkaslaypirsgvpimlvSEARQVDDQG
mretifnidpqlLEILVCPLTKGNLTLISEGTELLSKKASlaypirsgvpimlvSEARQVDDQG
MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG
******N**PQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVS**R******
MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG
****IFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEAR******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooo
oooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG
MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG
MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
31512190264 hypothetical protein CKC_00760 [Candidatus Liberibacter 1 5e-21
22215012762 hypothetical protein Avi_4243 [Agrobacterium vitis S4] 1 6e-15
21846196962 hypothetical protein RetlK5_21903 [Rhizobium etli Kim 5 1 7e-15
22782370462 hypothetical protein NGR_c31900 [Sinorhizobium fredii N 1 9e-15
8635955762 hypothetical protein RHE_CH03977 [Rhizobium etli CFN 42 1 9e-15
19089382562 hypothetical protein RHECIAT_CH0004260 [Rhizobium etli 1 1e-14
30730171266 protein of unknown function DUF343 [Sinorhizobium melil 1 1e-14
1596693962 hypothetical protein SMc03803 [Sinorhizobium meliloti 1 1 1e-14
11625429562 hypothetical protein RL4569 [Rhizobium leguminosarum bv 1 1e-14
20955134462 hypothetical protein Rleg2_3773 [Rhizobium leguminosaru 1 2e-14
>gi|315121902|ref|YP_004062391.1| hypothetical protein CKC_00760 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 64 Back     alignment and organism information
 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%)

Query: 1  MRETIFNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQV 60
          M+E + NIDP+LLEILVCPLTKGNL LISEG ELLSKKASL YPIRSGVPIMLV+EAR++
Sbjct: 1  MKENVPNIDPKLLEILVCPLTKGNLILISEGKELLSKKASLVYPIRSGVPIMLVAEARKM 60

Query: 61 DDQ 63
          D +
Sbjct: 61 DTK 63


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222150127|ref|YP_002551084.1| hypothetical protein Avi_4243 [Agrobacterium vitis S4] Length = 62 Back     alignment and organism information
>gi|218461969|ref|ZP_03502060.1| hypothetical protein RetlK5_21903 [Rhizobium etli Kim 5] Length = 62 Back     alignment and organism information
>gi|227823704|ref|YP_002827677.1| hypothetical protein NGR_c31900 [Sinorhizobium fredii NGR234] Length = 62 Back     alignment and organism information
>gi|86359557|ref|YP_471449.1| hypothetical protein RHE_CH03977 [Rhizobium etli CFN 42] Length = 62 Back     alignment and organism information
>gi|190893825|ref|YP_001980367.1| hypothetical protein RHECIAT_CH0004260 [Rhizobium etli CIAT 652] Length = 62 Back     alignment and organism information
>gi|307301712|ref|ZP_07581471.1| protein of unknown function DUF343 [Sinorhizobium meliloti BL225C] Length = 66 Back     alignment and organism information
>gi|15966939|ref|NP_387292.1| hypothetical protein SMc03803 [Sinorhizobium meliloti 1021] Length = 62 Back     alignment and organism information
>gi|116254295|ref|YP_770133.1| hypothetical protein RL4569 [Rhizobium leguminosarum bv. viciae 3841] Length = 62 Back     alignment and organism information
>gi|209551344|ref|YP_002283261.1| hypothetical protein Rleg2_3773 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 62 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
PRK1182760 PRK11827, PRK11827, hypothetical protein; Provisional 1e-07
pfam0396647 pfam03966, Trm112p, Trm112p-like protein 1e-05
COG283560 COG2835, COG2835, Uncharacterized conserved protein [Fu 1e-13
>gnl|CDD|183328 PRK11827, PRK11827, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|146547 pfam03966, Trm112p, Trm112p-like protein Back     alignment and domain information
>gnl|CDD|32663 COG2835, COG2835, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
PRK1182760 hypothetical protein; Provisional 99.9
COG283560 Uncharacterized conserved protein [Function unknown] 99.86
pfam0396647 Trm112p Trm112p-like protein. The function of this fami 99.27
KOG1088124 consensus 98.0
PRK05580 699 primosome assembly protein PriA; Validated 92.3
pfam0827140 TF_Zn_Ribbon TFIIB zinc-binding. The transcription fact 91.39
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 91.18
COG1645131 Uncharacterized Zn-finger containing protein [General f 90.9
PRK10220111 hypothetical protein; Provisional 90.47
>PRK11827 hypothetical protein; Provisional Back     alignment and domain information
>COG2835 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam03966 Trm112p Trm112p-like protein Back     alignment and domain information
>KOG1088 consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>pfam08271 TF_Zn_Ribbon TFIIB zinc-binding Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
2jr6_A68 Solution Structure Of Upf0434 Protein Nma0874. Nort 2e-17
2pk7_A69 Crystal Structure Of The Q4kft4_psef5 Protein From 3e-16
2js4_A70 Solution Nmr Structure Of Bordetella Bronchiseptica 2e-15
2hf1_A68 Crystal Structure Of The Putative Tetraacyldisaccha 3e-14
2jny_A67 Solution Nmr Structure Of Protein Uncharacterized B 1e-13
2kpi_A56 Solution Nmr Structure Of Streptomyces Coelicolor S 2e-11
2k5r_A97 Solution Nmr Structure Of Xf2673 From Xylella Fasti 4e-04
>gi|157835281|pdb|2JR6|A Chain A, Solution Structure Of Upf0434 Protein Nma0874. Northeast Structural Genomics Target Mr32 Length = 68 Back     alignment and structure
 Score = 92.6 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 40/56 (71%)

Query: 8  IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63
          ++ + L+ILVCP+TKG L    +  EL S++A LAYPI+ G+P ML +EAR + ++
Sbjct: 1  MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEE 56


>gi|146386708|pdb|2PK7|A Chain A, Crystal Structure Of The Q4kft4_psef5 Protein From Pseudomonas Fluorescens. Nesg Target Plr1 Length = 69 Back     alignment and structure
>gi|152149169|pdb|2JS4|A Chain A, Solution Nmr Structure Of Bordetella Bronchiseptica Protein Bb2007. Northeast Structural Genomics Consortium Target Bor54 Length = 70 Back     alignment and structure
>gi|114794358|pdb|2HF1|A Chain A, Crystal Structure Of The Putative Tetraacyldisaccharide-1-P 4-Kinase From Chromobacterium Violaceum. Nesg Target Cvr39. Length = 68 Back     alignment and structure
>gi|146386932|pdb|2JNY|A Chain A, Solution Nmr Structure Of Protein Uncharacterized Bcr, Northeast Structural Genomics Consortium Target Cgr1 Length = 67 Back     alignment and structure
gi|285803116|pdb|2KPI|A Chain A, Solution Nmr Structure Of Streptomyces Coelicolor Sco3027 Modeled With Zn+2 Bound, Northeast Structural Genomics Consortium Target Rr58 Length = 56 Back     alignment and structure
>gi|197304920|pdb|2K5R|A Chain A, Solution Nmr Structure Of Xf2673 From Xylella Fastidiosa. Northeast Structural Genomics Consortium Target Xfr39 Length = 97 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosy 1e-17
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural geno 2e-17
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetraacyl 4e-17
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, structural 6e-17
2jr6_A68 UPF0434 protein NMA0874; solution, structural genomics, 6e-17
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI-2, NE 9e-16
2k5r_A97 Uncharacterized protein XF2673; solution structure, str 4e-12
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthesis, NESG, structural genomics, PSI-2; 1.90A {Chromobacterium violaceum atcc 12472} SCOP: b.171.1.1 Length = 68 Back     alignment and structure
 Score = 83.5 bits (207), Expect = 1e-17
 Identities = 27/56 (48%), Positives = 37/56 (66%)

Query: 8  IDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ 63
          +D + LEILVCPL KG L       EL+ K   LA+PI+ G+P+ML SEAR++  +
Sbjct: 1  MDAKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKDGIPMMLESEARELAPE 56


>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Length = 70 Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4KFT4, structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens pf-5} SCOP: b.171.1.1 Length = 69 Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Length = 67 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491} Length = 68 Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Length = 56 Back     alignment and structure
>2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Length = 97 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, structural 99.89
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural geno 99.88
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosy 99.87
2jr6_A68 UPF0434 protein NMA0874; solution, structural genomics, 99.87
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetraacyl 99.87
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI-2, NE 99.86
2k5r_A97 Uncharacterized protein XF2673; solution structure, str 99.85
2j6a_A141 Protein TRM112; translation termination, methyltransfer 98.07
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; RLMA, 95.01
3k1f_M 197 Transcription initiation factor IIB; RNA polymerase II, 93.46
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, gene re 91.64
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription initi 90.95
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
Probab=99.89  E-value=8.4e-25  Score=151.65  Aligned_cols=58  Identities=38%  Similarity=0.758  Sum_probs=56.6

Q ss_pred             HHCCHHHHHHHCCCCCCCEEEEECCCCEEECHHCCCCCCCCCCEEECCHHHHEECCCC
Q ss_conf             0028688965116789873689567885775210812401176340587771304458
Q gi|254780739|r    6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ   63 (64)
Q Consensus         6 ~~~~~~LL~iL~CP~~k~~L~~~~~~~~Lvc~~~~~~YPI~dgIPvLL~deAr~l~~~   63 (64)
                      |+||++||+||+||+||++|.|++++++|+|++|+++|||+|||||||+||||+++++
T Consensus         1 M~~d~~LLeiL~CP~~k~~L~~~~~~~~Lvc~~~~~~YPI~dGIPvLL~deAr~l~~~   58 (67)
T 2jny_A            1 MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPN   58 (67)
T ss_dssp             CCSCGGGTCCCBCTTTCCBCEEETTTTEEEETTTTEEEEEETTEECCCSSCCEECCCC
T ss_pred             CCCCHHHHHHHCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCEECCCHHHHCCCCHH
T ss_conf             9989799988458798984069688998976876844735189601089992509998



>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthesis, NESG, structural genomics, PSI-2; 1.90A {Chromobacterium violaceum atcc 12472} SCOP: b.171.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491} Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4KFT4, structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens pf-5} SCOP: b.171.1.1 Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Back     alignment and structure
>2j6a_A Protein TRM112; translation termination, methyltransferase, transferase, ERF1, nuclear protein, protein methylation; 1.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
d2hf1a159 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromob 4e-17
d2jnya159 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg15 8e-17
d2pk7a159 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pse 1e-15
>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Length = 59 Back     information, alignment and structure

class: All beta proteins
fold: Trm112p-like
superfamily: Trm112p-like
family: Trm112p-like
domain: Hypothetical protein CV3345
species: Chromobacterium violaceum [TaxId: 536]
 Score = 80.4 bits (199), Expect = 4e-17
 Identities = 27/54 (50%), Positives = 35/54 (64%)

Query: 9  DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62
          D + LEILVCPL KG L       EL+ K   LA+PI+ G+P+ML SEAR++  
Sbjct: 1  DAKFLEILVCPLCKGPLVFDKSKDELICKGDRLAFPIKDGIPMMLESEARELAP 54


>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Length = 59 Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Length = 59 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebacterium 99.88
d2hf1a159 Hypothetical protein CV3345 {Chromobacterium violaceum 99.85
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluorescen 99.85
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [TaxId: 5 95.36
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal domai 91.92
d1pfta_50 Transcription initiation factor TFIIB, N-terminal domai 90.42
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
class: All beta proteins
fold: Trm112p-like
superfamily: Trm112p-like
family: Trm112p-like
domain: Uncharacterized protein Cgl1405/cg1592
species: Corynebacterium glutamicum [TaxId: 1718]
Probab=99.88  E-value=3.2e-24  Score=147.32  Aligned_cols=59  Identities=37%  Similarity=0.747  Sum_probs=56.9

Q ss_pred             HHCCHHHHHHHCCCCCCCEEEEECCCCEEECHHCCCCCCCCCCEEECCHHHHEECCCCC
Q ss_conf             00286889651167898736895678857752108124011763405877713044589
Q gi|254780739|r    6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQG   64 (64)
Q Consensus         6 ~~~~~~LL~iL~CP~~k~~L~~~~~~~~Lvc~~~~~~YPI~dgIPvLL~deAr~l~~~~   64 (64)
                      |+||++||+||+||.||++|+|++++++|+|++|+++|||+|||||||+||||+++.+.
T Consensus         1 M~~~~~LL~iL~CP~ck~~L~~~~~~~~Lvc~~~~~~YPI~dgIPvLL~deA~~l~~~~   59 (59)
T d2jnya1           1 MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPNN   59 (59)
T ss_dssp             CCSCGGGTCCCBCTTTCCBCEEETTTTEEEETTTTEEEEEETTEECCCSSCCEECCCCC
T ss_pred             CCCCHHHHHHHCCCCCCCEEEEECCCCEEECCCCCCCCCCCCCCCCCCHHHHCCCCCCC
T ss_conf             99797999871587999870796889989748648545252995021899930177899



>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 64 hypothetical protein CLIBASIA_03130 [Candidatus Li
2pk7_A_69 (A:) Uncharacterized protein; NESG, PLR1, putative 2e-16
2js4_A_70 (A:) UPF0434 protein BB2007; NESG, northeast struc 2e-16
2hf1_A_68 (A:) Tetraacyldisaccharide-1-P 4-kinase; LPXK, lip 2e-16
2jr6_A_68 (A:) UPF0434 protein NMA0874; solution, structural 3e-16
2jny_A_67 (A:) Uncharacterized BCR; structure, CGR1, NESG, s 4e-16
2kpi_A_56 (A:) Uncharacterized protein SCO3027; zinc finger, 1e-15
2k5r_A_97 (A:) Uncharacterized protein XF2673; solution stru 5e-12
>2pk7_A (A:) Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4KFT4, structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens pf-5}Length = 69 Back     alignment and structure
 Score = 79.4 bits (196), Expect = 2e-16
 Identities = 30/54 (55%), Positives = 39/54 (72%)

Query: 9  DPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDD 62
          D +LL+IL CP+ KG L L ++ TEL+SK A LAYPIR G+P+ L SEAR +  
Sbjct: 2  DTKLLDILACPICKGPLKLSADKTELISKGAGLAYPIRDGIPVXLESEARTLTT 55


>2js4_A (A:) UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50}Length = 70 Back     alignment and structure
>2hf1_A (A:) Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthesis, NESG, structural genomics, PSI-2; 1.90A {Chromobacterium violaceum atcc 12472}Length = 68 Back     alignment and structure
>2jr6_A (A:) UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491}Length = 68 Back     alignment and structure
>2jny_A (A:) Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum}Length = 67 Back     alignment and structure
>2kpi_A (A:) Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor}Length = 56 Back     alignment and structure
>2k5r_A (A:) Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1}Length = 97 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target64 hypothetical protein CLIBASIA_03130 [Candidatus Liberib
2jny_A_67 Uncharacterized BCR; structure, CGR1, NESG, struct 99.88
2pk7_A_69 Uncharacterized protein; NESG, PLR1, putative tetr 99.87
2js4_A_70 UPF0434 protein BB2007; NESG, northeast structural 99.86
2hf1_A_68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 99.86
2kpi_A_56 Uncharacterized protein SCO3027; zinc finger, PSI- 99.86
2jr6_A_68 UPF0434 protein NMA0874; solution, structural geno 99.86
2k5r_A_97 Uncharacterized protein XF2673; solution structure 99.83
2j6a_A_141 Protein TRM112; translation termination, methyltra 98.05
1p91_A_ 269 Ribosomal RNA large subunit methyltransferase A; R 95.8
3k1f_M_1-5757 Transcription initiation factor IIB; RNA polymeras 95.09
1pft_A_50 TFIIB, PFTFIIBN; N-terminal domain, transcription 93.9
1dl6_A_58 Transcription factor II B (TFIIB); zinc ribbon; NM 93.74
>2jny_A (A:) Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} Back     alignment and structure
Probab=99.88  E-value=5.9e-24  Score=147.99  Aligned_cols=58  Identities=38%  Similarity=0.758  Sum_probs=56.5

Q ss_pred             HHCCHHHHHHHCCCCCCCEEEEECCCCEEECHHCCCCCCCCCCEEECCHHHHEECCCC
Q ss_conf             0028688965116789873689567885775210812401176340587771304458
Q gi|254780739|r    6 FNIDPQLLEILVCPLTKGNLTLISEGTELLSKKASLAYPIRSGVPIMLVSEARQVDDQ   63 (64)
Q Consensus         6 ~~~~~~LL~iL~CP~~k~~L~~~~~~~~Lvc~~~~~~YPI~dgIPvLL~deAr~l~~~   63 (64)
                      |+||++||+||+||.||++|+|+.+.++|+|+.|+++|||+|||||||+||||.++++
T Consensus         1 M~~d~~LL~iL~CP~ck~~L~~~~~~~~Lvc~~~~~~yPI~dGIPvlL~dear~~~~~   58 (67)
T 2jny_A            1 MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPN   58 (67)
T ss_dssp             CCSCGGGTCCCBCTTTCCBCEEETTTTEEEETTTTEEEEEETTEECCCSSCCEECCCC
T ss_pred             CCCCHHHHHHHCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCCCCCCHHHHCCCCHH
T ss_conf             9979799988268798984659488997988865844635389010089994519999



>2pk7_A (A:) Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4KFT4, structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2js4_A (A:) UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2hf1_A (A:) Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthesis, NESG, structural genomics, PSI-2; 1.90A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2kpi_A (A:) Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>2jr6_A (A:) UPF0434 protein NMA0874; solution, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium; NMR {Neisseria meningitidis Z2491} Back     alignment and structure
>2k5r_A (A:) Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Back     alignment and structure
>2j6a_A (A:) Protein TRM112; translation termination, methyltransferase, transferase, ERF1, nuclear protein, protein methylation; 1.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1p91_A (A:) Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} Back     alignment and structure
>3k1f_M (M:1-57) Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pft_A (A:) TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} Back     alignment and structure
>1dl6_A (A:) Transcription factor II B (TFIIB); zinc ribbon; NMR {Homo sapiens} Back     alignment and structure