254780754

254780754

inorganic polyphosphate/ATP-NAD kinase

GeneID in NCBI database:8209759Locus tag:CLIBASIA_03205
Protein GI in NCBI database:254780754Protein Accession:YP_003065167.1
Gene range:+(512719, 513513)Protein Length:264aa
Gene description:inorganic polyphosphate/ATP-NAD kinase
COG prediction:[G] Predicted sugar kinase
KEGG prediction:ppnK; inorganic polyphosphate/ATP-NAD kinase (EC:2.7.1.23); K00858 NAD+ kinase [EC:2.7.1.23]
SEED prediction:NAD kinase (EC 2.7.1.23)
Pathway involved in KEGG:Nicotinate and nicotinamide metabolism [PATH:las00760]
Subsystem involved in SEED:NAD and NADP cofactor biosynthesis global
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFSS
cccccEEEEEEEcccHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHccccccEEEEEcccccEEEccccHHHHHHHHHHHHHcccEEEEEEEEEccccccEEEEEEEEEEEEEEccccccccEEEEEEEEEccEEEEEEEEccEEEEEccccHHHHHHHccccEEcccccEEEEEEEcccccccccEEEEccccEEEEEEccccccEEEEEEccEEcccccEEEEEEccccEEEEEEcccccHHHHHHHHHccc
cccccccEEEEEcccHHHHHHHHHHHHHHccccHHcccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHcccccHHHHHHHHcccccEEEEEEEEEEEEEEcccccccccEEEEEEEEEcccEEEHHEccccEEEEcccccccHEcccccccccccccEEEEEccccccccccccEEEccccEEEEEEEccccccEEEEccccccccccEEEEEEccccEEEEEccccccHHHHHHHHHHcc
MDRNIQKIHFKASNAKKAQEAYDKFVKIygnstseeADVIVVLGGDgfmlqsfhqskeydkpiygmncgsvgFLMNEYCIENLVERLSVAVectfhplkmtvfdydnsicaenilainevsiirkpgqnQLVQAAKLevkvddqvrlpelvcdglvvstpigstaynfsalgpilplesrhllltpvspfkprrwhgailpndvMIEIQVLehkqrpviatadrlaiepvsrinvtqssditMRILSDSHRSWSDRILTAQFSS
mdrniqkihfkasnakkaqEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIatadrlaiepvsrinvtqssditmrilsdshrswsdriltaqfss
MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFSS
***NIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFS*
MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFSS
***NIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFSS
MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFSS
MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
315121917261 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe 1 1e-108
222085648257 NAD(+) kinase protein [Agrobacterium radiobacter K84] L 1 4e-80
325292705257 inorganic polyphosphate/ATP-NAD kinase [Agrobacterium s 1 3e-73
116251521257 inorganic polyphosphate/ATP-NAD kinase [Rhizobium legum 1 1e-72
86357285257 inorganic polyphosphate/ATP-NAD kinase [Rhizobium etli 1 2e-72
327191366257 inorganic polyphosphate/ATP-NAD kinase [Rhizobium etli 1 2e-72
15888671257 inorganic polyphosphate/ATP-NAD kinase [Agrobacterium t 1 2e-72
218663195257 inorganic polyphosphate/ATP-NAD kinase [Rhizobium etli 1 2e-72
241204142257 inorganic polyphosphate/ATP-NAD kinase [Rhizobium legum 1 4e-72
190891334257 NAD(+) kinase [Rhizobium etli CIAT 652] Length = 257 1 4e-72
>gi|315121917|ref|YP_004062406.1| inorganic polyphosphate/ATP-NAD kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Back     alignment and organism information
 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/262 (71%), Positives = 224/262 (85%), Gaps = 3/262 (1%)

Query: 1   MDRNIQKIHFKASNAKKAQEAYDKFVKIYGNSTSEEADVIVVLGGDGFMLQSFHQSKEYD 60
           M RNIQKIHF+AS ++KAQEAY +F+KIY NS+ EE+D IV+LGGDGFMLQ+   S+ + 
Sbjct: 1   MRRNIQKIHFRASKSEKAQEAYKEFMKIYENSSYEESDAIVILGGDGFMLQNL--SRLHG 58

Query: 61  KPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEV 120
           KP+YG+NCGSVGFLMN+YC +N++ERLS A+E TFHPLKM VFD  +SICAE    +NEV
Sbjct: 59  KPLYGINCGSVGFLMNDYCTKNILERLSDAIEYTFHPLKMIVFDDTDSICAE-FFGVNEV 117

Query: 121 SIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESR 180
           SI+RK   +Q+VQAAKL+V ++ QVRLPELVCDGL+V+TP+GSTAYNFSALGPILP  S 
Sbjct: 118 SILRKLVSDQVVQAAKLKVTINSQVRLPELVCDGLIVATPLGSTAYNFSALGPILPFGSP 177

Query: 181 HLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVTQSSD 240
           HL+LTPVSPFKPRRW GA+L NDV+IEIQVLEH+QRPVIATADRLAIEPVSR+ +T S D
Sbjct: 178 HLVLTPVSPFKPRRWSGAVLSNDVIIEIQVLEHQQRPVIATADRLAIEPVSRLRITHSPD 237

Query: 241 ITMRILSDSHRSWSDRILTAQF 262
            TMRILSD +R WSDRIL AQF
Sbjct: 238 TTMRILSDPNRPWSDRILAAQF 259


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085648|ref|YP_002544178.1| NAD(+) kinase protein [Agrobacterium radiobacter K84] Length = 257 Back     alignment and organism information
>gi|325292705|ref|YP_004278569.1| inorganic polyphosphate/ATP-NAD kinase [Agrobacterium sp. H13-3] Length = 257 Back     alignment and organism information
>gi|116251521|ref|YP_767359.1| inorganic polyphosphate/ATP-NAD kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 257 Back     alignment and organism information
>gi|86357285|ref|YP_469177.1| inorganic polyphosphate/ATP-NAD kinase [Rhizobium etli CFN 42] Length = 257 Back     alignment and organism information
>gi|327191366|gb|EGE58392.1| inorganic polyphosphate/ATP-NAD kinase [Rhizobium etli CNPAF512] Length = 257 Back     alignment and organism information
>gi|15888671|ref|NP_354352.1| inorganic polyphosphate/ATP-NAD kinase [Agrobacterium tumefaciens str. C58] Length = 257 Back     alignment and organism information
>gi|218663195|ref|ZP_03519125.1| inorganic polyphosphate/ATP-NAD kinase [Rhizobium etli IE4771] Length = 257 Back     alignment and organism information
>gi|241204142|ref|YP_002975238.1| inorganic polyphosphate/ATP-NAD kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 257 Back     alignment and organism information
>gi|190891334|ref|YP_001977876.1| NAD(+) kinase [Rhizobium etli CIAT 652] Length = 257 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
PRK04761246 PRK04761, ppnK, inorganic polyphosphate/ATP-NAD kinase; 3e-98
pfam01513243 pfam01513, NAD_kinase, ATP-NAD kinase 6e-24
PRK14075256 PRK14075, pnk, inorganic polyphosphate/ATP-NAD kinase; 1e-16
PRK03372306 PRK03372, ppnK, inorganic polyphosphate/ATP-NAD kinase; 3e-16
PRK02231272 PRK02231, ppnK, inorganic polyphosphate/ATP-NAD kinase; 7e-16
PRK02155291 PRK02155, ppnK, NAD(+)/NADH kinase family protein; Prov 3e-14
COG0061281 COG0061, COG0061, Predicted sugar kinase [Carbohydrate 3e-40
PRK03708277 PRK03708, ppnK, inorganic polyphosphate/ATP-NAD kinase; 1e-19
KOG2178409 KOG2178, KOG2178, KOG2178, Predicted sugar kinase [Carb 1e-14
PRK01185271 PRK01185, ppnK, inorganic polyphosphate/ATP-NAD kinase; 2e-14
PLN02935508 PLN02935, PLN02935, Bifunctional NADH kinase/NAD(+) kin 1e-10
PLN02727986 PLN02727, PLN02727, NAD kinase 3e-08
PRK00561259 PRK00561, ppnK, inorganic polyphosphate/ATP-NAD kinase; 6e-05
PRK04539296 PRK04539, ppnK, inorganic polyphosphate/ATP-NAD kinase; 3e-15
PRK14076569 PRK14076, pnk, inorganic polyphosphate/ATP-NAD kinase; 6e-15
PRK01231295 PRK01231, ppnK, inorganic polyphosphate/ATP-NAD kinase; 3e-14
PRK02645305 PRK02645, ppnK, inorganic polyphosphate/ATP-NAD kinase; 4e-14
PRK01911292 PRK01911, ppnK, inorganic polyphosphate/ATP-NAD kinase; 6e-14
PRK03378292 PRK03378, ppnK, inorganic polyphosphate/ATP-NAD kinase; 2e-13
PRK14077287 PRK14077, pnk, inorganic polyphosphate/ATP-NAD kinase; 1e-12
PRK02649305 PRK02649, ppnK, inorganic polyphosphate/ATP-NAD kinase; 2e-12
PRK04885265 PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; 4e-09
PRK03501264 PRK03501, ppnK, inorganic polyphosphate/ATP-NAD kinase; 1e-08
KOG4180395 KOG4180, KOG4180, KOG4180, Predicted kinase [General fu 0.004
>gnl|CDD|179876 PRK04761, ppnK, inorganic polyphosphate/ATP-NAD kinase; Reviewed Back     alignment and domain information
>gnl|CDD|144927 pfam01513, NAD_kinase, ATP-NAD kinase Back     alignment and domain information
>gnl|CDD|184489 PRK14075, pnk, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179573 PRK03372, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|167337 PRK02231, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179379 PRK02155, ppnK, NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>gnl|CDD|30410 COG0061, COG0061, Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|179635 PRK03708, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|37389 KOG2178, KOG2178, KOG2178, Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|179241 PRK01185, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|178523 PLN02935, PLN02935, Bifunctional NADH kinase/NAD(+) kinase Back     alignment and domain information
>gnl|CDD|178328 PLN02727, PLN02727, NAD kinase Back     alignment and domain information
>gnl|CDD|100598 PRK00561, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179862 PRK04539, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|184490 PRK14076, pnk, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179257 PRK01231, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179455 PRK02645, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179352 PRK01911, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179574 PRK03378, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|172567 PRK14077, pnk, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179456 PRK02649, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179889 PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|179584 PRK03501, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>gnl|CDD|39382 KOG4180, KOG4180, KOG4180, Predicted kinase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
PRK04761246 ppnK inorganic polyphosphate/ATP-NAD kinase; Reviewed 100.0
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK03378292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK04759294 consensus 100.0
PRK02155291 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK01231296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK04539296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK01911290 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK00561259 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK03372303 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK04885265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK02645304 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK03501264 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK03708278 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK01185272 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
PRK02231272 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisiona 100.0
COG0061281 nadF NAD kinase [Coenzyme metabolism] 100.0
pfam01513243 NAD_kinase ATP-NAD kinase. Members of this family inclu 100.0
KOG2178409 consensus 100.0
PRK11914304 diacylglycerol kinase; Reviewed 98.02
PRK13337305 putative lipid kinase; Reviewed 98.01
PRK13055334 putative lipid kinase; Reviewed 97.94
PRK12361546 hypothetical protein; Provisional 97.41
PRK13054299 lipid kinase; Reviewed 97.35
PRK00861296 putative lipid kinase; Reviewed 97.31
COG1597301 LCB5 Sphingosine kinase and enzymes related to eukaryot 96.72
PRK13057287 putative lipid kinase; Reviewed 96.13
KOG4180395 consensus 99.81
TIGR00147316 TIGR00147 conserved hypothetical protein TIGR00147; Int 96.98
TIGR02482302 PFKA_ATP 6-phosphofructokinase; InterPro: IPR012828 6-p 97.55
TIGR02483339 PFK_mixed phosphofructokinase; InterPro: IPR012829 Memb 97.53
PRK13059294 putative lipid kinase; Reviewed 97.48
COG3199355 Predicted inorganic polyphosphate/ATP-NAD kinase [Gener 97.17
PRK03202323 6-phosphofructokinase; Provisional 96.41
cd00763317 Bacterial_PFK Phosphofructokinase, a key regulatory enz 95.94
PRK06555403 pyrophosphate--fructose-6-phosphate 1-phosphotransferas 95.77
COG0205347 PfkA 6-phosphofructokinase [Carbohydrate transport and 95.44
PTZ00286486 6-phospho-1-fructokinase; Provisional 95.04
cd00363338 PFK Phosphofructokinase, a key regulatory enzyme in gly 94.96
PRK06830442 diphosphate--fructose-6-phosphate 1-phosphotransferase; 94.87
cd00764762 Eukaryotic_PFK Phosphofructokinase, a key regulatory en 94.66
cd00764 762 Eukaryotic_PFK Phosphofructokinase, a key regulatory en 94.37
pfam00365279 PFK Phosphofructokinase. 95.85
smart00046124 DAGKc Diacylglycerol kinase catalytic domain (presumed) 93.34
pfam00781127 DAGK_cat Diacylglycerol kinase catalytic domain. Diacyl 92.55
PRK08250235 glutamine amidotransferase; Provisional 90.16
PRK13143201 hisH imidazole glycerol phosphate synthase subunit HisH 92.42
PRK13146208 hisH imidazole glycerol phosphate synthase subunit HisH 90.19
>PRK04761 ppnK inorganic polyphosphate/ATP-NAD kinase; Reviewed Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04759 consensus Back     alignment and domain information
>PRK02155 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK00561 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03501 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG0061 nadF NAD kinase [Coenzyme metabolism] Back     alignment and domain information
>pfam01513 NAD_kinase ATP-NAD kinase Back     alignment and domain information
>KOG2178 consensus Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK13055 putative lipid kinase; Reviewed Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PRK13054 lipid kinase; Reviewed Back     alignment and domain information
>PRK00861 putative lipid kinase; Reviewed Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>PRK13057 putative lipid kinase; Reviewed Back     alignment and domain information
>KOG4180 consensus Back     alignment and domain information
>TIGR00147 TIGR00147 conserved hypothetical protein TIGR00147; InterPro: IPR005218 Although the proteins in this group all contain the diacylglycerol kinase catalytic domain, their function is, as yet, unknown Back     alignment and domain information
>TIGR02482 PFKA_ATP 6-phosphofructokinase; InterPro: IPR012828 6-phosphofructokinase (2 Back     alignment and domain information
>TIGR02483 PFK_mixed phosphofructokinase; InterPro: IPR012829 Members of this family that are characterised, save one, are phosphofructokinases dependent on pyrophosphate (2 Back     alignment and domain information
>PRK13059 putative lipid kinase; Reviewed Back     alignment and domain information
>COG3199 Predicted inorganic polyphosphate/ATP-NAD kinase [General function prediction only] Back     alignment and domain information
>PRK03202 6-phosphofructokinase; Provisional Back     alignment and domain information
>cd00763 Bacterial_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>PRK06555 pyrophosphate--fructose-6-phosphate 1-phosphotransferase; Validated Back     alignment and domain information
>COG0205 PfkA 6-phosphofructokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00286 6-phospho-1-fructokinase; Provisional Back     alignment and domain information
>cd00363 PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>PRK06830 diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional Back     alignment and domain information
>cd00764 Eukaryotic_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>cd00764 Eukaryotic_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate Back     alignment and domain information
>pfam00365 PFK Phosphofructokinase Back     alignment and domain information
>smart00046 DAGKc Diacylglycerol kinase catalytic domain (presumed) Back     alignment and domain information
>pfam00781 DAGK_cat Diacylglycerol kinase catalytic domain Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
1y3h_A307 Crystal Structure Of Inorganic PolyphosphateATP-Nad 2e-24
1u0r_A307 Crystal Structure Of Mycobacterium Tuberculosis Nad 2e-24
2an1_A292 Structural Genomics, The Crystal Structure Of A Put 1e-21
1yt5_A258 Crystal Structure Of Nad Kinase From Thermotoga Mar 2e-21
2i1w_A272 Crystal Structure Of Nad Kinase 1 From Listeria Mon 3e-18
2q5f_A272 Crystal Structure Of Lmnadk1 From Listeria Monocyto 4e-18
2i2f_A272 Crystal Structure Of Lmnadk1 Length = 272 4e-17
3pfn_A365 Crystal Structure Of Human Nad Kinase Length = 365 3e-16
1suw_A249 Crystal Structure Of A Nad Kinase From Archaeoglobu 4e-16
1z0s_A278 Crystal Structure Of An Nad Kinase From Archaeoglob 5e-16
3afo_A388 Crystal Structure Of Yeast Nadh Kinase Complexed Wi 1e-14
>gi|60594102|pdb|1Y3H|A Chain A, Crystal Structure Of Inorganic PolyphosphateATP-Nad Kinase From Mycobacterium Tuberculosis Length = 307 Back     alignment and structure
 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/237 (24%), Positives = 103/237 (43%), Gaps = 12/237 (5%)

Query: 30  GNSTSEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFL--MNEYCIENLVERL 87
               ++  ++++VLGGDG  L++   ++    P+ G+N G +GFL       I+ ++E +
Sbjct: 69  DQHAADGCELVLVLGGDGTFLRAAELARNASIPVLGVNLGRIGFLAEAEAEAIDAVLEHV 128

Query: 88  SVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRL 147
                     L + V             A+NEVS+ + P    L    ++     D   +
Sbjct: 129 VAQDYRVEDRLTLDVVVRQGGRIVNRGWALNEVSLEKGPRLGVLGVVVEI-----DGRPV 183

Query: 148 PELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIE 207
               CDG++VSTP GSTAY FSA GP+L  +   +L+ P +            P    I 
Sbjct: 184 SAFGCDGVLVSTPTGSTAYAFSAGGPVLWPDLEAILVVPNNAHALFGRPMVTSPE-ATIA 242

Query: 208 IQVLEHKQRPVIATADRLA--IEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQF 262
           I++       ++    R    I   SR+ VT+    +++        ++DR++  +F
Sbjct: 243 IEIEADGHDALVFCDGRREMLIPAGSRLEVTR-CVTSVKWARLDSAPFTDRLVR-KF 297


gi|52695960|pdb|1U0R|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Nad Kinase Length = 307 Back     alignment and structure
gi|78101385|pdb|2AN1|A Chain A, Structural Genomics, The Crystal Structure Of A Putative Kinase From Salmonella Typhimurim Lt2 Length = 292 Back     alignment and structure
gi|62738751|pdb|1YT5|A Chain A, Crystal Structure Of Nad Kinase From Thermotoga Maritima Length = 258 Back     alignment and structure
>gi|157835148|pdb|2I1W|A Chain A, Crystal Structure Of Nad Kinase 1 From Listeria Monocytogenes Length = 272 Back     alignment and structure
>gi|157835831|pdb|2Q5F|A Chain A, Crystal Structure Of Lmnadk1 From Listeria Monocytogenes Length = 272 Back     alignment and structure
>gi|157835158|pdb|2I2F|A Chain A, Crystal Structure Of Lmnadk1 Length = 272 Back     alignment and structure
>gi|311772317|pdb|3PFN|A Chain A, Crystal Structure Of Human Nad Kinase Length = 365 Back     alignment and structure
gi|52695575|pdb|1SUW|A Chain A, Crystal Structure Of A Nad Kinase From Archaeoglobus Fulgidus In Complex With Its Substrate And Product: Insights Into The Catalysis Of Nad Kinase Length = 249 Back     alignment and structure
>gi|66361279|pdb|1Z0S|A Chain A, Crystal Structure Of An Nad Kinase From Archaeoglobus Fulgidus In Complex With Atp Length = 278 Back     alignment and structure
>gi|326327788|pdb|3AFO|A Chain A, Crystal Structure Of Yeast Nadh Kinase Complexed With Nadh Length = 388 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
3pfn_A365 NAD kinase; structural genomics consortium, SNP, SGC, t 1e-35
2i2c_A272 Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP 5e-33
1z0s_A278 Probable inorganic polyphosphate/ATP-NAD kinase; ATP-bi 1e-26
1yt5_A258 Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha 5e-21
1u0t_A307 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, bet 3e-20
2an1_A292 Putative kinase; structural genomics, PSI, protein stru 3e-20
>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens} Length = 365 Back     alignment and structure
 Score =  145 bits (366), Expect = 1e-35
 Identities = 59/252 (23%), Positives = 100/252 (39%), Gaps = 38/252 (15%)

Query: 34  SEEADVIVVLGGDGFMLQSFHQSKEYDKPIYGMNCGSVGFLMN------EYCIENLVE-- 85
           S + D I+ LGGDG +L +    +    P+   + GS+GFL        +  +  ++E  
Sbjct: 106 SNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGN 165

Query: 86  -------RLSVAVECTFHPLKMTV-------------FDYDNSICAENILAINEVSIIRK 125
                  RL V V       K  V              D D    A     +NEV I R 
Sbjct: 166 AAVVLRSRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQYQVLNEVVIDRG 225

Query: 126 PGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLT 185
           P        + ++V +D  + +  +  DG++VSTP GSTAY  +A   ++      +++T
Sbjct: 226 PSS----YLSNVDVYLDGHL-ITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMIT 280

Query: 186 PVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATAD---RLAIEPVSRINVTQSS-DI 241
           P+ P     +   ++P  V ++I +    +     + D   R  I     I++T S   +
Sbjct: 281 PICPHSL-SFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPL 339

Query: 242 TMRILSDSHRSW 253
               + D    W
Sbjct: 340 PSICVRDPVSDW 351


>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A* Length = 272 Back     alignment and structure
>1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* Length = 278 Back     alignment and structure
>1yt5_A Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} Length = 258 Back     alignment and structure
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A Length = 307 Back     alignment and structure
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2} Length = 292 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
2an1_A292 Putative kinase; structural genomics, PSI, protein stru 100.0
3pfn_A365 NAD kinase; structural genomics consortium, SNP, SGC, t 100.0
2i2c_A272 Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP 100.0
1u0t_A307 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, bet 100.0
1yt5_A258 Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha 100.0
1z0s_A278 Probable inorganic polyphosphate/ATP-NAD kinase; ATP-bi 100.0
2qv7_A337 Diacylglycerol kinase DGKB; alpha-beta domain 1, beta s 97.96
2bon_A332 Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9 97.24
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two do 96.48
2a9v_A212 GMP synthase; NP_394403.1, , structural genomics, joint 91.23
3opy_A989 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fr 95.36
3pfk_A319 Phosphofructokinase; transferase(phosphotransferase); 2 95.12
1zxx_A319 6-phosphofructokinase; allosteric regulation, lactobaci 94.99
2hig_A487 6-phospho-1-fructokinase; transferase; 2.40A {Trypanoso 94.95
1pfk_A320 Phosphofructokinase; transferase(phosphotransferase); H 94.65
3hno_A419 Pyrophosphate-dependent phosphofructokinase; structural 94.46
3opy_B941 6-phosphofructo-1-kinase beta-subunit; ATP binding, fru 93.53
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding, fru 93.29
3opy_A 989 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fr 93.28
2f48_A 555 Diphosphate--fructose-6-phosphate 1- phosphotransferase 92.76
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural genomic 90.25
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2} Back     alignment and structure
Probab=100.00  E-value=0  Score=431.84  Aligned_cols=253  Identities=23%  Similarity=0.358  Sum_probs=214.3

Q ss_pred             CCCCCEEEEEEECC-CHHHHHHHHHHHHHCCCC--------------------------CHHHCCEEEEECCCHHHHHHH
Q ss_conf             98765059999559-989999999999870788--------------------------845577999987954899999
Q gi|254780754|r    1 MDRNIQKIHFKASN-AKKAQEAYDKFVKIYGNS--------------------------TSEEADVIVVLGGDGFMLQSF   53 (264)
Q Consensus         1 m~~~~~ki~i~~~~-~~~a~~~~~~l~~~~~~~--------------------------~~~~~Dlii~iGGDGT~L~a~   53 (264)
                      |.+.+|+|+++++. .+.+.++++++.+++.+.                          ..+++|++|++|||||||+|+
T Consensus         1 M~~~~k~Igiv~~~~~~~~~~~~~~i~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlvi~iGGDGT~L~a~   80 (292)
T 2an1_A            1 MNNHFKCIGIVGHPRHPTALTTHEMLYRWLCDQGYEVIVEQQIAHELQLKNVPTGTLAEIGQQADLAVVVGGDGNMLGAA   80 (292)
T ss_dssp             ---CCCEEEEECC-------CHHHHHHHHHHHTTCEEEEEHHHHHHTTCSSCCEECHHHHHHHCSEEEECSCHHHHHHHH
T ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEECHHHHHHCCCCCCCCCCHHHCCCCCCEEEEECCCHHHHHHH
T ss_conf             99779589999539998999999999999997889999968888664877777554445055777899992685799999


Q ss_pred             HHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEEEEC---CCCCCCEEEEEEEEEEEEECCCCCC
Q ss_conf             9974128729941534332010445878999866420124320344345421---2444420157753479972687642
Q gi|254780754|r   54 HQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDY---DNSICAENILAINEVSIIRKPGQNQ  130 (264)
Q Consensus        54 ~~~~~~~~PilGIn~G~lGFL~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~---~~~~~~~~~~AlNEi~i~r~~~~~~  130 (264)
                      |.+.+.++||+|||+|++|||+ +++++++.+.+.++..+.+..+++..+..   ......+.++||||++|.|+...  
T Consensus        81 ~~~~~~~~PilGIn~G~lGFL~-~~~~~~~~~~l~~~~~g~~~~~~r~~l~~~~~~~~~~~~~~~AlNdvvi~~~~~~--  157 (292)
T 2an1_A           81 RTLARYDINVIGINRGNLGFLT-DLDPDNALQQLSDVLEGRYISEKRFLLEAQVCQQDRQKRISTAINEVVLHPGKVA--  157 (292)
T ss_dssp             HHHTTSSCEEEEBCSSSCCSSC-CBCTTSHHHHHHHHHTTCEEEEEEEEEEEEEECC----CEEEESSEEEEEESSTT--
T ss_pred             HHHCCCCCCEEEEECCCCEEEE-ECCCHHHHHHHHHHHHCCCEEEEEEEEEEEEEECCCCHHHHHHHEEEEECCCCCC--
T ss_conf             9837689838987658842477-3361138999999873673132344567776411110000212015540268853--


Q ss_pred             EEEEEEEEEEECCEEEEEEEECCEEEEECCCCHHHHHHHCCCEEEEECCCEEEEECCCCCCHHHHHHCCCCCCCEEEEEE
Q ss_conf             36788898766787653121035079822665044675229817740886058630354330111100278841489997
Q gi|254780754|r  131 LVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQV  210 (264)
Q Consensus       131 ~~~~~~~~v~id~~~~~~~~~~DGvivSTptGSTAY~lSaGGpIv~p~~~~~~itpI~p~~l~~~rplVl~~~~~I~i~i  210 (264)
                        +++++++++||++ +.+|+|||+||||||||||||+||||||++|+++++++||||||+++. ||+|+|++++|++++
T Consensus       158 --~~~~~~v~id~~~-~~~~~gDGlIvSTptGSTAY~lSaGGpIv~p~~~~~~itpI~p~~l~~-rplV~~~~~~i~i~~  233 (292)
T 2an1_A          158 --HMIEFEVYIDETF-AFSQRSDGLIISTPTGSTAYSLSAGGPILTPSLDAITLVPMFPHTLSA-RPLVINSSSTIRLRF  233 (292)
T ss_dssp             --CCEEEEEEETTEE-EEEEEESEEEEECTGGGGTHHHHTTCCEECTTCSEEEEEEESCSSTTC-CCEEEETTCCEEEEE
T ss_pred             --EEEEEEEEECCCC-CEEECCCCEEECCCCCHHHHHHHCCCCCCCCCHHEEEEEECCCCCCCC-CCCCCCCCEEEEEEE
T ss_conf             --3799999845621-447745889998667657999768997427312004531225766667-970249963999997


Q ss_pred             CCCCCCEEEEEECCE---ECCCCCEEEEEECCCCCEEEEECCCCCHHHHHHHHHCC
Q ss_conf             487887589998898---81487789999879951899964888899988887517
Q gi|254780754|r  211 LEHKQRPVIATADRL---AIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFS  263 (264)
Q Consensus       211 ~~~~~~~~~~~~D~~---~~~~~~~i~I~~s~~~~~~li~~~~~~f~~ril~~kF~  263 (264)
                      .. ..+++.++.||+   ++.+++.|+|++|+ ..++++++++++||++ |++||.
T Consensus       234 ~~-~~~~~~l~~DG~~~~~l~~gd~I~I~~s~-~~~~lv~~~~~~f~~~-L~~KL~  286 (292)
T 2an1_A          234 SH-RRSDLEISCDSQIALPIQEGEDVLIRRCD-YHLNLIHPKDYSYFNT-LSTKLG  286 (292)
T ss_dssp             CC----CEEEEETTSCCEEECTTCEEEEEEEE-EEEEEEEETTCCHHHH-HHHHHT
T ss_pred             CC-CCCCEEEEEECCCCEEECCCCEEEEEECC-CEEEEEECCCCCHHHH-HHHHCC
T ss_conf             48-99878999938800870899799999899-8799998299999999-987778



>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens} Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A* Back     alignment and structure
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A Back     alignment and structure
>1yt5_A Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} Back     alignment and structure
>1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* Back     alignment and structure
>2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP complex, transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A Back     alignment and structure
>2bon_A Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>2a9v_A GMP synthase; NP_394403.1, , structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3pfk_A Phosphofructokinase; transferase(phosphotransferase); 2.40A {Geobacillus stearothermophilus} SCOP: c.89.1.1 PDB: 4pfk_A* 6pfk_A 1mto_A* Back     alignment and structure
>1zxx_A 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2hig_A 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A* Back     alignment and structure
>1pfk_A Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} SCOP: c.89.1.1 PDB: 2pfk_A Back     alignment and structure
>3hno_A Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_A Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>2f48_A Diphosphate--fructose-6-phosphate 1- phosphotransferase; HET: FBP; 2.11A {Borrelia burgdorferi B31} SCOP: c.89.1.1 PDB: 1kzh_A* Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, infectious diseases, isomerase, center for structural genomics of infectious diseases; 2.35A {Vibrio cholerae} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
d1z0sa1249 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kina 1e-24
d1u0ta_302 e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase Pp 2e-21
>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Length = 249 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: NAD kinase/diacylglycerol kinase-like
superfamily: NAD kinase/diacylglycerol kinase-like
family: NAD kinase-like
domain: Inorganic polyphosphate/ATP-NAD kinase PpnK
species: Archaeoglobus fulgidus [TaxId: 2234]
 Score =  107 bits (267), Expect = 1e-24
 Identities = 58/249 (23%), Positives = 111/249 (44%), Gaps = 23/249 (9%)

Query: 8   IHFKASNAKKAQEAYDKF---VKIYGNSTS--EEADVIVVLGGDGFMLQSFHQSKEYDKP 62
           ++    + K+ +EA  +    V+++   +   E  D IV +GGDG +L+   + K    P
Sbjct: 6   VYKTDGHVKRIEEALKRLEVEVELFNQPSEELENFDFIVSVGGDGTILRILQKLK-RCPP 64

Query: 63  IYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSI 122
           I+G+N G VG L +        E   V ++      ++  F   +     ++LA+NE+++
Sbjct: 65  IFGINTGRVGLLTHAS-----PENFEVELKKAVEKFEVERFPRVSCSAMPDVLALNEIAV 119

Query: 123 IRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHL 182
           + +     +           D V +  + CDG +V+T IGST Y FSA GP++       
Sbjct: 120 LSRKPAKMIDV-----ALRVDGVEVDRIRCDGFIVATQIGSTGYAFSAGGPVVEPYLECF 174

Query: 183 LLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATAD-RLAIEPVSRINVTQSSDI 241
           +L P++PF    W   ++  +  IE+          I  AD + +++    I + +S   
Sbjct: 175 ILIPIAPF-RFGWKPYVVSMERKIEVIA-----EKAIVVADGQKSVDFDGEITIEKSEFP 228

Query: 242 TMRILSDSH 250
            +   ++  
Sbjct: 229 AVFFKNEKR 237


>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 302 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
d1u0ta_302 Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacter 100.0
d1z0sa1249 Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglo 100.0
d2qv7a1312 Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxI 97.9
d2bona1295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 97.32
d4pfka_319 ATP-dependent phosphofructokinase {Bacillus stearotherm 94.65
d1pfka_320 ATP-dependent phosphofructokinase {Escherichia coli [Ta 94.26
d2f48a1 550 Pyrophosphate-dependent phosphofructokinase {Lyme disea 93.81
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus thermophil 90.32
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplasma ac 92.6
>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: NAD kinase/diacylglycerol kinase-like
superfamily: NAD kinase/diacylglycerol kinase-like
family: NAD kinase-like
domain: Inorganic polyphosphate/ATP-NAD kinase PpnK
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00  E-value=0  Score=416.69  Aligned_cols=248  Identities=25%  Similarity=0.396  Sum_probs=206.1

Q ss_pred             EEEEEEEC-CCHHHHHHHHHHHHHCCCC---------------------------------------CHHHCCEEEEECC
Q ss_conf             05999955-9989999999999870788---------------------------------------8455779999879
Q gi|254780754|r    6 QKIHFKAS-NAKKAQEAYDKFVKIYGNS---------------------------------------TSEEADVIVVLGG   45 (264)
Q Consensus         6 ~ki~i~~~-~~~~a~~~~~~l~~~~~~~---------------------------------------~~~~~Dlii~iGG   45 (264)
                      +|+.++.+ ..+++.+.++++.+++.+.                                       ..+++|++|++||
T Consensus         1 r~v~lv~~~~k~~a~~~a~~i~~~L~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlvi~lGG   80 (302)
T d1u0ta_           1 RSVLLVVHTGRDEATETARRVEKVLGDNKIALRVLSAEAVDRGSLHLAPDDMRAMGVEIEVVDADQHAADGCELVLVLGG   80 (302)
T ss_dssp             CEEEEEESSSGGGGSHHHHHHHHHHHTTTCEEEEEC-----------------------------------CCCEEEEEC
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCEEEEECC
T ss_conf             98999970989899999999999999789989998420001464445711343227642113553233346558999758


Q ss_pred             CHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEE---EECCCCCCCEEEEEEEEEEE
Q ss_conf             548999999974128729941534332010445878999866420124320344345---42124444201577534799
Q gi|254780754|r   46 DGFMLQSFHQSKEYDKPIYGMNCGSVGFLMNEYCIENLVERLSVAVECTFHPLKMTV---FDYDNSICAENILAINEVSI  122 (264)
Q Consensus        46 DGT~L~a~~~~~~~~~PilGIn~G~lGFL~~~~~~~~~~~~l~~~~~~~~~~~~~~~---~~~~~~~~~~~~~AlNEi~i  122 (264)
                      |||||+|+|.+.+.++||||||+|+||||+ +++++++.+.+.+...+.+..+++..   ...+++......+||||++|
T Consensus        81 DGT~L~a~~~~~~~~~PilGin~G~lGFL~-~~~~~~~~~~l~~~~~g~~~~~~r~~l~~~~~~~~~~~~~~~alNdvvi  159 (302)
T d1u0ta_          81 DGTFLRAAELARNASIPVLGVNLGRIGFLA-EAEAEAIDAVLEHVVAQDYRVEDRLTLDVVVRQGGRIVNRGWALNEVSL  159 (302)
T ss_dssp             HHHHHHHHHHHHHHTCCEEEEECSSCCSSC-SEEGGGHHHHHHHHHHTCCEEEEECCEEEEEEETTEEEEEEEESSEEEE
T ss_pred             CHHHHHHHHHHHCCCCEEEEECCCCCCEEC-CCCHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCEEEEHHHHHHHHC
T ss_conf             739999999740039828983788630541-4545678999999874476201100122576169804520333201102


Q ss_pred             EECCCCCCEEEEEEEEEEECCEEEEEEEECCEEEEECCCCHHHHHHHCCCEEEEECCCEEEEECCCCCCHHHHHHCCCCC
Q ss_conf             72687642367888987667876531210350798226650446752298177408860586303543301111002788
Q gi|254780754|r  123 IRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVVSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPN  202 (264)
Q Consensus       123 ~r~~~~~~~~~~~~~~v~id~~~~~~~~~~DGvivSTptGSTAY~lSaGGpIv~p~~~~~~itpI~p~~l~~~rplVl~~  202 (264)
                      .|+...    +++.+++++||++ +++|+|||+||||||||||||+||||||++|++++|++||||||+++. ||+|+|+
T Consensus       160 ~~~~~~----~~~~~~v~i~~~~-~~~~~~DGlivSTPtGSTAYslSaGGPIv~p~~~~i~vtpi~p~sl~~-rplVl~~  233 (302)
T d1u0ta_         160 EKGPRL----GVLGVVVEIDGRP-VSAFGCDGVLVSTPTGSTAYAFSAGGPVLWPDLEAILVVPNNAHALFG-RPMVTSP  233 (302)
T ss_dssp             ECSSSS----SCEEEEEESSSSE-EEEEEESEEEEECTGGGGTHHHHTTCCEECTTCCCEEEEEESCSSSCC-CCEEECT
T ss_pred             CCCCCC----CEEEEEEEECCEE-EEEEECCEEEEEHHHCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCC-CEEEECC
T ss_conf             357654----4246899961325-788612418984142057401205686444334222101134423567-4388669


Q ss_pred             CCEEEEEECCCCCCEEEEEECCE---ECCCCCEEEEEECCCCCEEEEECCCCCHHHHHHHHHCC
Q ss_conf             41489997487887589998898---81487789999879951899964888899988887517
Q gi|254780754|r  203 DVMIEIQVLEHKQRPVIATADRL---AIEPVSRINVTQSSDITMRILSDSHRSWSDRILTAQFS  263 (264)
Q Consensus       203 ~~~I~i~i~~~~~~~~~~~~D~~---~~~~~~~i~I~~s~~~~~~li~~~~~~f~~ril~~kF~  263 (264)
                      +++|++++.... +++.++.||+   ++.++++|.|++|+ .++++++..+++||++ +++||.
T Consensus       234 ~~~i~i~~~~~~-~~~~v~~DG~~~~~l~~~d~I~I~~s~-~~~~lv~~~~~~f~~~-l~~Kl~  294 (302)
T d1u0ta_         234 EATIAIEIEADG-HDALVFCDGRREMLIPAGSRLEVTRCV-TSVKWARLDSAPFTDR-LVRKFR  294 (302)
T ss_dssp             TCCEEEEECTTS-CCEEEEETTTEEEEECTTCEEEEEECS-SCEEEEECSCCCHHHH-HHHHHT
T ss_pred             CCEEEEEEECCC-CCEEEEEECCCCEEECCCCEEEEEECC-CEEEEEEECCCCHHHH-HHHHCC
T ss_conf             848999981489-878999989955870899799999889-8899998189998999-999759



>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f48a1 c.89.1.1 (A:4-553) Pyrophosphate-dependent phosphofructokinase {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 264 inorganic polyphosphate/ATP-NAD kinase [Candidatus
2i2c_A_94-250157 (A:94-250) Probable inorganic polyphosphate/ATP-NA 6e-25
1yt5_A_79-240162 (A:79-240) Inorganic polyphosphate/ATP-NAD kinase; 2e-22
2an1_A_128-264137 (A:128-264) Putative kinase; structural genomics, 7e-21
1u0t_A_140-276137 (A:140-276) Inorganic polyphosphate/ATP-NAD kinase 1e-20
1z0s_A_131-255125 (A:131-255) Probable inorganic polyphosphate/ATP-N 3e-17
1z0s_A_1-130_256-265140 (A:1-130,A:256-265) Probable inorganic polyphospha 4e-16
2i2c_A_1-9393 (A:1-93) Probable inorganic polyphosphate/ATP-NAD 2e-14
1u0t_A_1-139_277-286149 (A:1-139,A:277-286) Inorganic polyphosphate/ATP-NA 3e-14
1yt5_A_1-7878 (A:1-78) Inorganic polyphosphate/ATP-NAD kinase; d 3e-11
2an1_A_1-127_265-275138 (A:1-127,A:265-275) Putative kinase; structural ge 9e-09
>2i2c_A (A:94-250) Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A*Length = 157 Back     alignment and structure
 Score =  108 bits (272), Expect = 6e-25
 Identities = 34/156 (21%), Positives = 57/156 (36%), Gaps = 12/156 (7%)

Query: 98  LKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLVV 157
           LK TV        A   LA+NE ++              ++V ++D         DGL +
Sbjct: 10  LKTTVKYGIGKKEATY-LALNESTVKSSG------GPFVVDVVINDI-HFERFRGDGLCM 61

Query: 158 STPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGA----ILPNDVMIEIQVLEH 213
           STP G+TAYN S  G ++      + LT ++    R +       + P   ++ +Q +  
Sbjct: 62  STPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVND 121

Query: 214 KQRPVIATADRLAIEPVSRINVTQSSDITMRILSDS 249
           K   +      +    V  I    S+         S
Sbjct: 122 KDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRS 157


>1yt5_A (A:79-240) Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima}Length = 162 Back     alignment and structure
>2an1_A (A:128-264) Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2}Length = 137 Back     alignment and structure
>1u0t_A (A:140-276) Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis}Length = 137 Back     alignment and structure
>1z0s_A (A:131-255) Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus}Length = 125 Back     alignment and structure
>1z0s_A (A:1-130,A:256-265) Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus}Length = 140 Back     alignment and structure
>2i2c_A (A:1-93) Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A*Length = 93 Back     alignment and structure
>1u0t_A (A:1-139,A:277-286) Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis}Length = 149 Back     alignment and structure
>1yt5_A (A:1-78) Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima}Length = 78 Back     alignment and structure
>2an1_A (A:1-127,A:265-275) Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2}Length = 138 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target264 inorganic polyphosphate/ATP-NAD kinase [Candidatus Libe
1yt5_A_79-240162 Inorganic polyphosphate/ATP-NAD kinase; domain 1: 100.0
1u0t_A_140-276137 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta 100.0
2an1_A_128-264137 Putative kinase; structural genomics, PSI, protein 100.0
2i2c_A_94-250157 Probable inorganic polyphosphate/ATP-NAD kinase 1; 100.0
1z0s_A_131-255125 Probable inorganic polyphosphate/ATP-NAD kinase; A 100.0
2i2c_A_1-9393 Probable inorganic polyphosphate/ATP-NAD kinase 1; 99.81
1z0s_A_1-130_256-265140 Probable inorganic polyphosphate/ATP-NAD kinase; A 99.76
1u0t_A_1-139_277-286149 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta 99.74
2an1_A_1-127_265-275138 Putative kinase; structural genomics, PSI, protein 99.62
1yt5_A_1-7878 Inorganic polyphosphate/ATP-NAD kinase; domain 1: 99.6
2qv7_A_1-140140 Diacylglycerol kinase DGKB; alpha-beta domain 1, b 97.79
2bon_A_1-143_311-332165 Lipid kinase; DAG kinase, ATP-binding, transferase 97.25
3dzc_A_1-196_382-396211 UDP-N-acetylglucosamine 2-epimerase; structural ge 95.41
3l83_A_250 Glutamine amido transferase; structural genomics, 94.76
2nv0_A_196 Glutamine amidotransferase subunit PDXT; 3-layer(A 93.26
1t3t_A_1023-1303281 Phosphoribosylformylglycinamidine synthase; PURL, 91.84
1o1y_A_239 Conserved hypothetical protein TM1158; structural 91.65
1zxx_A_1-131_253-303182 6-phosphofructokinase; allosteric regulation, lact 96.08
1pfk_A_1-132_254-306185 Phosphofructokinase; transferase(phosphotransferas 95.96
3pfk_A_1-131_251-305186 Phosphofructokinase; transferase(phosphotransferas 95.64
2hig_A_28-234_388-429249 6-phospho-1-fructokinase; transferase; 2.40A {Tryp 94.88
3hno_A_1-148_302-364211 Pyrophosphate-dependent phosphofructokinase; struc 91.6
1v4v_A_1-176_349-376204 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 91.1
2f48_A_1-211_433-504283 Diphosphate--fructose-6-phosphate 1- phosphotransf 94.22
>1yt5_A (A:79-240) Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=4.5e-41  Score=279.03  Aligned_cols=161  Identities=25%  Similarity=0.368  Sum_probs=145.0

Q ss_pred             CCCHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCEEEEEEEEEEEEECCCCCCEEEEEEEEEEECCEEEEEEEECCEEE
Q ss_conf             45878999866420124320344345421244442015775347997268764236788898766787653121035079
Q gi|254780754|r   77 EYCIENLVERLSVAVECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPGQNQLVQAAKLEVKVDDQVRLPELVCDGLV  156 (264)
Q Consensus        77 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~AlNEi~i~r~~~~~~~~~~~~~~v~id~~~~~~~~~~DGvi  156 (264)
                      +++++++.+.|+++.+++|..+++..+....  ..+.++||||++|.|....    +++++++++||++ +++|+|||||
T Consensus         2 ~~~~~~~~~~l~~~~~g~~~~~~~~~l~v~~--~~~~~~AlNEv~i~~~~~~----~~~~~~i~id~~~-~~~~~~DGli   74 (162)
T 1yt5_A            2 SYTLDEIDRFLEDLRNWNFREETRWFIQIES--ELGNHLALNDVTLERDLSG----KMVEIEVEVEHHS-SMWFFADGVV   74 (162)
T ss_dssp             CBCGGGHHHHHHHHHTTCCEEEEEEEEEEEE--TTEEEEESSEEEEECCTTS----CCEEEEEEETTSC-CEEEEESEEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCCEEHHHHCCCC--CHHHHHHHCCCCCCCCCCC----CCEEEEEEEECEE-EEEEEEEEEE
T ss_conf             0121347888777750443200000111122--1022455456412368876----5336999981428-9876311499


Q ss_pred             EECCCCHHHHHHHCCCEEEEECCCEEEEECCCCCCHHHHHHCCCCCCCEEEEEECCCCCCEEEEEECCEECCCCCEEEEE
Q ss_conf             82266504467522981774088605863035433011110027884148999748788758999889881487789999
Q gi|254780754|r  157 VSTPIGSTAYNFSALGPILPLESRHLLLTPVSPFKPRRWHGAILPNDVMIEIQVLEHKQRPVIATADRLAIEPVSRINVT  236 (264)
Q Consensus       157 vSTptGSTAY~lSaGGpIv~p~~~~~~itpI~p~~l~~~rplVl~~~~~I~i~i~~~~~~~~~~~~D~~~~~~~~~i~I~  236 (264)
                      |||||||||||+||||||++|++++|++||||||+++ +||+|+|++++|++++.    +++.++.||++++++++|+|+
T Consensus        75 VsTptGSTaY~~SagGpii~p~~~~~~itpi~P~~~~-~rp~v~~~~~~i~i~~~----~~~~i~~DG~~l~~~~~i~I~  149 (162)
T 1yt5_A           75 ISTPTGSTAYSLSIGGPIIFPECEVLEISPIAPQFFL-TRSVVIPSNFKVVVESQ----RDINMLVDGVLTGKTKRIEVK  149 (162)
T ss_dssp             EECTGGGGTTTTTTTCCCCCTTCCEEEEEEESCSTTC-CCCEEEETTSCEEEEEE----EEEEEEETTEEEEEEEEEEEE
T ss_pred             EECCCCCCHHHHHCCCCCCCCCCCEEEEEEECCCCCC-CCCCCCCCCEEEEEECC----CCEEEEEEEEECCCCCEEEEE
T ss_conf             8434453267774698531886332789862351013-68877887339999359----984999964793899799999


Q ss_pred             ECCCCCEEEEECCC
Q ss_conf             87995189996488
Q gi|254780754|r  237 QSSDITMRILSDSH  250 (264)
Q Consensus       237 ~s~~~~~~li~~~~  250 (264)
                      ++. .+++++++++
T Consensus       150 ~s~-~~~~li~~~~  162 (162)
T 1yt5_A          150 KSR-RYVRILRPPE  162 (162)
T ss_dssp             EEE-EEEEEEECTT
T ss_pred             ECC-CEEEEEEECC
T ss_conf             989-7899998399



>1u0t_A (A:140-276) Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2an1_A (A:128-264) Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2} Back     alignment and structure
>2i2c_A (A:94-250) Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A* Back     alignment and structure
>1z0s_A (A:131-255) Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2i2c_A (A:1-93) Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 2i2f_A* 2q5f_A* Back     alignment and structure
>1z0s_A (A:1-130,A:256-265) Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1u0t_A (A:1-139,A:277-286) Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2an1_A (A:1-127,A:265-275) Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2} Back     alignment and structure
>1yt5_A (A:1-78) Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qv7_A (A:1-140) Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP complex, transferase; HET: ADP; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2bon_A (A:1-143,A:311-332) Lipid kinase; DAG kinase, ATP-binding, transferase; 1.9A {Escherichia coli} Back     alignment and structure
>3dzc_A (A:1-196,A:382-396) UDP-N-acetylglucosamine 2-epimerase; structural genomics, infectious diseases, isomerase; 2.35A {Vibrio cholerae} Back     alignment and structure
>2nv0_A (A:) Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} Back     alignment and structure
>1t3t_A (A:1023-1303) Phosphoribosylformylglycinamidine synthase; PURL, FGAM synthetase, PURS, PURQ, formyl glycinamide, ligase; HET: CYG ADP; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1o1y_A (A:) Conserved hypothetical protein TM1158; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.70A {Thermotoga maritima} Back     alignment and structure
>1zxx_A (A:1-131,A:253-303) 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1pfk_A (A:1-132,A:254-306) Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} Back     alignment and structure
>3pfk_A (A:1-131,A:251-305) Phosphofructokinase; transferase(phosphotransferase); 2.40A {Bacillus stearothermophilus} Back     alignment and structure
>2hig_A (A:28-234,A:388-429) 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A* Back     alignment and structure
>3hno_A (A:1-148,A:302-364) Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_A Back     alignment and structure
>1v4v_A (A:1-176,A:349-376) UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} Back     alignment and structure
>2f48_A (A:1-211,A:433-504) Diphosphate--fructose-6-phosphate 1- phosphotransferase; HET: FBP; 2.11A {Borrelia burgdorferi B31} Back     alignment and structure