254780755

254780755

octaprenyl-diphosphate synthase protein

GeneID in NCBI database:8209760Locus tag:CLIBASIA_03210
Protein GI in NCBI database:254780755Protein Accession:YP_003065168.1
Gene range:+(511504, 512472)Protein Length:322aa
Gene description:octaprenyl-diphosphate synthase protein
COG prediction:[H] Geranylgeranyl pyrophosphate synthase
KEGG prediction:ispB; octaprenyl-diphosphate synthase protein; K02523 octaprenyl diphosphate synthase [EC:2.5.1.-]
SEED prediction:Octaprenyl-diphosphate synthase (EC 2.5.1.-) / Dimethylallyltransferase (EC 2.5.1.1) / Geranyltranstransferase (farnesyldiphosphate synthase) (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis: Interconversions;
Polyprenyl Diphosphate Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN
cHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHccccccHHHHHccccHEHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccHHcccccHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc
mkmledltlkDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATllhddvvddsalrRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELrqlslsknldvteeDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKnigedfrngkptlPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYgqkakdslrclpdsswkKSLMEVVDFCLQRLN
mkmledltlkdmEKVNFLILKricsdvemiPDVVKYLifsggkrlrPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKnigedfrngkptlPVILAfqrgtkreknfwkstindgkisveNLKKAFIIMRENRALVDTEYRAYsygqkakdslrcLPDSSWKKSLMEVVDFCLQRLN
MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN
*KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTIND*****ENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRL*
MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN
MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN
MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN
MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRLN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target322 octaprenyl-diphosphate synthase protein [Candidatus Lib
254781111237 geranyltranstransferase protein [Candidatus Liberi 3e-17
>gi|254781111|ref|YP_003065524.1| geranyltranstransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 237 Back     alignment
 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 100/190 (52%), Gaps = 11/190 (5%)

Query: 33  VVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLHDDV--VDDSAL 90
            ++Y +  GGK++R  L    A +        + +  AIE IH  +L+HDD+  +D+  +
Sbjct: 42  AIRYALL-GGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYI 100

Query: 91  RRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQ--EALEALSLVACTLAEGELRQL 148
           RRGK    + +   T+++ G+ LL+ AF ++   K+Q  + + +  +++ T   G L+ +
Sbjct: 101 RRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIG-LQGM 159

Query: 149 SLSKNLDVTEE-----DYLHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGI 203
              + LD+ +E         + K KT  L   A E  +++A    + ++ L+ +G NLGI
Sbjct: 160 LGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGI 219

Query: 204 AFQLVDDVLD 213
            FQL DD+LD
Sbjct: 220 IFQLADDLLD 229

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target322 octaprenyl-diphosphate synthase protein [Candidatus Lib
315121918322 octaprenyl-diphosphate synthase protein [Candidatus Lib 1 1e-156
222085054455 octaprenyl-diphosphate synthase protein [Agrobacterium 1 1e-111
86356521346 octaprenyl-diphosphate synthase protein [Rhizobium etli 1 1e-105
327192818338 octaprenyl-diphosphate synthase protein [Rhizobium etli 1 1e-105
190890586346 octaprenyl-diphosphate synthase [Rhizobium etli CIAT 65 1 1e-105
116250711338 octaprenyl-diphosphate synthase [Rhizobium leguminosaru 1 1e-105
209548129338 polyprenyl synthetase [Rhizobium leguminosarum bv. trif 1 1e-105
254701208338 hypothetical protein Bsuib55_10162 [Brucella suis bv. 5 1 1e-105
241203314338 Farnesyltranstransferase [Rhizobium leguminosarum bv. t 1 1e-105
261751747340 polyprenyl synthetase [Brucella suis bv. 5 str. 513] Le 1 1e-105
>gi|315121918|ref|YP_004062407.1| octaprenyl-diphosphate synthase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 322 Back     alignment and organism information
 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/322 (83%), Positives = 296/322 (91%)

Query: 1   MKMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
           MKMLE LT+KDM KVN LI+ RICS+V +IPDVVKYLIFSGGKRLRPMLT+ATALMLEYR
Sbjct: 1   MKMLEALTVKDMNKVNLLIMDRICSNVTIIPDVVKYLIFSGGKRLRPMLTVATALMLEYR 60

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G+NHVLLACAIEFIHTATLLHDDVVDDSALRRGK AARLVWGNQ SVLVGDFLLSQAF M
Sbjct: 61  GNNHVLLACAIEFIHTATLLHDDVVDDSALRRGKAAARLVWGNQASVLVGDFLLSQAFSM 120

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           VIETKSQEAL+ LSLVACTL+EGELRQLS+SKNL+VTEEDYL+VIKSKTA LF AALEVS
Sbjct: 121 VIETKSQEALKVLSLVACTLSEGELRQLSISKNLNVTEEDYLYVIKSKTAALFVAALEVS 180

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
           SLI+G Q+SVR ALKSYG NLGIAFQLVDD LDYRGEVNEMGKNIG+DFRNGKPTLPVIL
Sbjct: 181 SLISGAQDSVRDALKSYGTNLGIAFQLVDDALDYRGEVNEMGKNIGDDFRNGKPTLPVIL 240

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           AFQR T +EKNFW+STI DG+ISVENL+KA I+++E  ALVDT+ +AY YGQKAKDSL+ 
Sbjct: 241 AFQRATNQEKNFWRSTIGDGEISVENLQKALIMIQECNALVDTKSQAYYYGQKAKDSLQD 300

Query: 301 LPDSSWKKSLMEVVDFCLQRLN 322
           LP++ WK SL+EVVDFCLQRL+
Sbjct: 301 LPNNPWKASLIEVVDFCLQRLD 322


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085054|ref|YP_002543583.1| octaprenyl-diphosphate synthase protein [Agrobacterium radiobacter K84] Length = 455 Back     alignment and organism information
>gi|86356521|ref|YP_468413.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CFN 42] Length = 346 Back     alignment and organism information
>gi|327192818|gb|EGE59745.1| octaprenyl-diphosphate synthase protein [Rhizobium etli CNPAF512] Length = 338 Back     alignment and organism information
>gi|190890586|ref|YP_001977128.1| octaprenyl-diphosphate synthase [Rhizobium etli CIAT 652] Length = 346 Back     alignment and organism information
>gi|116250711|ref|YP_766549.1| octaprenyl-diphosphate synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 338 Back     alignment and organism information
>gi|209548129|ref|YP_002280046.1| polyprenyl synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 338 Back     alignment and organism information
>gi|254701208|ref|ZP_05163036.1| hypothetical protein Bsuib55_10162 [Brucella suis bv. 5 str. 513] Length = 338 Back     alignment and organism information
>gi|241203314|ref|YP_002974410.1| Farnesyltranstransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 338 Back     alignment and organism information
>gi|261751747|ref|ZP_05995456.1| polyprenyl synthetase [Brucella suis bv. 5 str. 513] Length = 340 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target322 octaprenyl-diphosphate synthase protein [Candidatus Lib
PRK10888323 PRK10888, PRK10888, octaprenyl diphosphate synthase; Pr 2e-72
COG0142322 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [C 6e-72
CHL00151323 CHL00151, preA, prenyl transferase; Reviewed 3e-48
TIGR02749322 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase 4e-47
PLN02857416 PLN02857, PLN02857, octaprenyl-diphosphate synthase 8e-45
KOG0776384 KOG0776, KOG0776, KOG0776, Geranylgeranyl pyrophosphate 3e-42
TIGR02748319 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase 8e-42
cd00685259 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Syn 1e-72
pfam00348260 pfam00348, polyprenyl_synt, Polyprenyl synthetase 8e-55
cd00867236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Syntha 6e-51
cd00385243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis 2e-35
PRK10581299 PRK10581, PRK10581, geranyltranstransferase; Provisiona 9e-22
KOG0777322 KOG0777, KOG0777, KOG0777, Geranylgeranyl pyrophosphate 7e-15
KOG0711347 KOG0711, KOG0711, KOG0711, Polyprenyl synthetase [Coenz 5e-07
PLN02890422 PLN02890, PLN02890, geranyl diphosphate synthase 1e-30
>gnl|CDD|182813 PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30491 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|131796 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|178448 PLN02857, PLN02857, octaprenyl-diphosphate synthase Back     alignment and domain information
>gnl|CDD|35995 KOG0776, KOG0776, KOG0776, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|131795 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase component II Back     alignment and domain information
>gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>gnl|CDD|144078 pfam00348, polyprenyl_synt, Polyprenyl synthetase Back     alignment and domain information
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|182567 PRK10581, PRK10581, geranyltranstransferase; Provisional Back     alignment and domain information
>gnl|CDD|35996 KOG0777, KOG0777, KOG0777, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|35930 KOG0711, KOG0711, KOG0711, Polyprenyl synthetase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|178478 PLN02890, PLN02890, geranyl diphosphate synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 322 octaprenyl-diphosphate synthase protein [Candidatus Lib
PRK10888323 octaprenyl diphosphate synthase; Provisional 100.0
TIGR02749325 prenyl_cyano solanesyl diphosphate synthase; InterPro: 100.0
TIGR02748325 GerC3_HepT heptaprenyl diphosphate synthase component I 100.0
cd00685298 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases (Tr 100.0
COG0142322 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme me 100.0
CHL00151288 preA prenyl transferase; Reviewed 100.0
PRK10581299 geranyltranstransferase; Provisional 100.0
KOG0776384 consensus 100.0
KOG0711347 consensus 100.0
pfam00348260 polyprenyl_synt Polyprenyl synthetase. 100.0
cd00867236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases (Trans 100.0
KOG0777322 consensus 100.0
cd00385243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, C 100.0
cd00683265 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthases (Tr 97.61
pfam00494262 SQS_PSY Squalene/phytoene synthase. 97.44
TIGR03464266 HpnC squalene synthase HpnC. This family of genes are m 97.22
TIGR03465266 HpnD squalene synthase HpnD. The genes of this family a 96.76
pfam07307212 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP sy 96.98
PRK13594278 consensus 90.06
>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>TIGR02749 prenyl_cyano solanesyl diphosphate synthase; InterPro: IPR014120 This entry contains solanesyl diphosphate synthases from cyanobacteria or plastid-containing eukaryotes Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II; InterPro: IPR014119 The proteins in this entry are component II of the heterodimeric heptaprenyl diphosphate synthase Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS), head-to-tail (HT) (1'-4) condensation reactions Back     alignment and domain information
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>CHL00151 preA prenyl transferase; Reviewed Back     alignment and domain information
>PRK10581 geranyltranstransferase; Provisional Back     alignment and domain information
>KOG0776 consensus Back     alignment and domain information
>KOG0711 consensus Back     alignment and domain information
>pfam00348 polyprenyl_synt Polyprenyl synthetase Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) of class 1 isoprenoid biosynthesis enzymes which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate Back     alignment and domain information
>KOG0777 consensus Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1; Superfamily of trans-isoprenyl diphosphate synthases (IPPS) and class I terpene cyclases which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate Back     alignment and domain information
>cd00683 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS), head-to-head (HH) (1'-1) condensation reaction Back     alignment and domain information
>pfam00494 SQS_PSY Squalene/phytoene synthase Back     alignment and domain information
>TIGR03464 HpnC squalene synthase HpnC Back     alignment and domain information
>TIGR03465 HpnD squalene synthase HpnD Back     alignment and domain information
>pfam07307 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1 Back     alignment and domain information
>PRK13594 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target322 octaprenyl-diphosphate synthase protein [Candidatus Lib
3mzv_A341 Crystal Structure Of A Decaprenyl Diphosphate Synth 8e-44
3oyr_A345 Crystal Structure Of Polyprenyl Synthase From Caulo 1e-34
1wy0_A342 Crystal Structure Of Geranylgeranyl Pyrophosphate S 6e-33
3lmd_A360 Crystal Structure Of Geranylgeranyl Pyrophosphate S 7e-33
3aqb_B325 M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphospha 6e-31
3rmg_A334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 1e-30
3apz_A348 Apo Form Of Arabidopsis MediumLONG-Chain Length Pre 2e-23
3aq0_A348 Ligand-Bound Form Of Arabidopsis MediumLONG-Chain L 5e-23
3n3d_A335 Crystal Structure Of Geranylgeranyl Pyrophosphate S 1e-19
3pko_A334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 2e-19
3kra_A295 Mint Heterotetrameric Geranyl Pyrophosphate Synthas 3e-18
3nf2_A352 Crystal Structure Of Polyprenyl Synthetase From Str 2e-15
3lji_A304 Crystal Structure Of Putative Geranyltranstransfera 1e-13
3p41_A303 Crystal Structure Of Polyprenyl Synthetase From Pse 2e-13
1wmw_A330 Crystal Structure Of Geranulgeranyl Diphosphate Syn 3e-12
3ipi_A295 Crystal Structure Of A Geranyltranstransferase From 3e-12
2for_A323 Crystal Structure Of The Shigella Flexneri Farnesyl 4e-12
1rqj_A299 Active Conformation Of Farnesyl Pyrophosphate Synth 9e-12
1rqi_A300 Active Conformation Of Farnesyl Pyrophosphate Synth 9e-12
3m9u_A309 Crystal Structure Of Geranylgeranyl Pyrophosphate S 2e-10
3lom_A313 Crystal Structure Of Geranyltransferase From Legion 3e-10
3lk5_A380 Crystal Structure Of Putative Geranylgeranyl Pyroph 5e-10
2q80_A301 Crystal Structure Of Human Geranylgeranyl Pyrophosp 7e-10
2h8o_A335 The 1.6a Crystal Structure Of The Geranyltransferas 1e-08
3p8r_A302 Crystal Structure Of Polyprenyl Synthase From Vibri 1e-07
1rtr_A301 Crystal Structure Of S. Aureus Farnesyl Pyrophospha 1e-06
2dh4_A340 Geranylgeranyl Pyrophosphate Synthase Length = 340 1e-05
1fps_A348 Crystal Structure Of Recombinant Farnesyl Diphospha 5e-05
1ubx_A367 Structure Of Farnesyl Pyrophosphate Synthetase Leng 9e-05
1ubv_A367 Structure Of Farnesyl Pyrophosphate Synthetase Leng 1e-04
2j1o_A268 Geranylgeranyl Diphosphate Synthase From Sinapis Al 1e-12
2j1p_A293 Geranylgeranyl Diphosphate Synthase From Sinapis Al 4e-12
3lvs_A298 Crystal Structure Of Farnesyl Diphosphate Synthase 2e-05
3p8l_A302 Crystal Structure Of Polyprenyl Synthase From Enter 4e-08
2ftz_A284 Crystal Structure Of Geranyltranstransferase (Ec 2. 1e-04
3llw_A311 Crystal Structure Of Geranyltransferase From Helico 3e-04
3q1o_A310 Crystal Structure Of Geranyltransferase From Helico 3e-04
>gi|297787795|pdb|3MZV|A Chain A, Crystal Structure Of A Decaprenyl Diphosphate Synthase From Rhodobacter Capsulatus Length = 341 Back     alignment and structure
 Score =  182 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 145/321 (45%), Positives = 203/321 (63%), Gaps = 1/321 (0%)

Query: 2   KMLEDLTLKDMEKVNFLILKRICSDV-EMIPDVVKYLIFSGGKRLRPMLTLATALMLEYR 60
             L     +DM  VN LI +R+ S+    IP+V  +LI +GGKRLRPMLTLA A ++ Y 
Sbjct: 12  DRLAQALAEDMAAVNALIRERMSSEHAPRIPEVTAHLIEAGGKRLRPMLTLAAARLVGYG 71

Query: 61  GDNHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCM 120
           G  HV LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F +
Sbjct: 72  GPFHVHLAATVEFIHTATLLHDDVVDESRQRRGRPTANLLWDNKSSVLVGDYLFARSFQL 131

Query: 121 VIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVS 180
           + +T +   +E L+  +  +AEGE+ QL+ ++NL  TE+ YL VI+ KTA LFSAA EV 
Sbjct: 132 MTDTGNMRVMEILANASAVIAEGEVLQLTAAQNLATTEDIYLRVIRGKTAALFSAATEVG 191

Query: 181 SLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVIL 240
            +I G      QAL  YG  LGIAFQ+VDD+LDY G+  E+GKN G+DFR  K T+PVI 
Sbjct: 192 GIIGGAPEDQVQALFDYGDALGIAFQIVDDLLDYGGKSAEIGKNTGDDFRERKLTMPVIK 251

Query: 241 AFQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRC 300
           A     + E+ FWK  I  G     +L+ A  +M ++  L  T   A  +   A+ +L  
Sbjct: 252 AVALADEAERAFWKRVIEKGDQQDGDLEHAMALMTKHGTLEATRLAAIGWTDTARKALAK 311

Query: 301 LPDSSWKKSLMEVVDFCLQRL 321
           LPD   ++ L ++ D+ ++R+
Sbjct: 312 LPDHPLRQMLDDLADYVVERV 332


>gi|308388198|pdb|3OYR|A Chain A, Crystal Structure Of Polyprenyl Synthase From Caulobacter Crescentus Cb15 Complexed With Calcium And Isoprenyl Diphosphate Length = 345 Back     alignment and structure
gi|90108478|pdb|1WY0|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthetase From Pyrococcus Horikoshii Ot3 Length = 342 Back     alignment and structure
>gi|288965865|pdb|3LMD|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Atcc 13032 Length = 360 Back     alignment and structure
>gi|311772001|pdb|3AQB|B Chain B, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate Synthase In Complex With Magnesium Length = 325 Back     alignment and structure
>gi|332639921|pdb|3RMG|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Bacteroides Thetaiotaomicron Length = 334 Back     alignment and structure
>gi|319443460|pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase Length = 348 Back     alignment and structure
>gi|319443462|pdb|3AQ0|A Chain A, Ligand-Bound Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase (Surface Polar Residue Mutant) Length = 348 Back     alignment and structure
>gi|297343242|pdb|3N3D|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase F Lactobacillus Brevis Atcc 367 Length = 335 Back     alignment and structure
>gi|312597572|pdb|3PKO|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Complexed With Citrate Length = 334 Back     alignment and structure
>gi|289526777|pdb|3KRA|A Chain A, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium Length = 295 Back     alignment and structure
>gi|302148849|pdb|3NF2|A Chain A, Crystal Structure Of Polyprenyl Synthetase From Streptomyces Coelicolor A3(2) Length = 352 Back     alignment and structure
>gi|288563197|pdb|3LJI|A Chain A, Crystal Structure Of Putative Geranyltranstransferase From Pseudomonas Fluorescens Pf-5 Length = 304 Back     alignment and structure
>gi|309320748|pdb|3P41|A Chain A, Crystal Structure Of Polyprenyl Synthetase From Pseudomonas Fluorescens Pf-5 Complexed With Magnesium And Isoprenyl Pyrophosphate Length = 303 Back     alignment and structure
gi|73535442|pdb|1WMW|A Chain A, Crystal Structure Of Geranulgeranyl Diphosphate Synthase From Thermus Thermophilus Length = 330 Back     alignment and structure
>gi|257472035|pdb|3IPI|A Chain A, Crystal Structure Of A Geranyltranstransferase From The Methanosarcina Mazei Length = 295 Back     alignment and structure
>gi|88193100|pdb|2FOR|A Chain A, Crystal Structure Of The Shigella Flexneri Farnesyl Pyrophosphate Synthase Complex With An Isopentenyl Pyrophosphate Length = 323 Back     alignment and structure
gi|46015527|pdb|1RQJ|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Risedronate Length = 299 Back     alignment and structure
>gi|46015525|pdb|1RQI|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Dimethylallyl S- Thiolodiphosphate Length = 300 Back     alignment and structure
>gi|293652046|pdb|3M9U|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Length = 309 Back     alignment and structure
>gi|288965921|pdb|3LOM|A Chain A, Crystal Structure Of Geranyltransferase From Legionella Pneumophila Length = 313 Back     alignment and structure
>gi|290790227|pdb|3LK5|A Chain A, Crystal Structure Of Putative Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Length = 380 Back     alignment and structure
>gi|150261574|pdb|2Q80|A Chain A, Crystal Structure Of Human Geranylgeranyl Pyrophosphate Synthase Bound To Ggpp Length = 301 Back     alignment and structure
>gi|110590588|pdb|2H8O|A Chain A, The 1.6a Crystal Structure Of The Geranyltransferase From Agrobacterium Tumefaciens Length = 335 Back     alignment and structure
>gi|310689999|pdb|3P8R|A Chain A, Crystal Structure Of Polyprenyl Synthase From Vibrio Cholerae Length = 302 Back     alignment and structure
>gi|46015555|pdb|1RTR|A Chain A, Crystal Structure Of S. Aureus Farnesyl Pyrophosphate Synthase Length = 301 Back     alignment and structure
>gi|93279242|pdb|2DH4|A Chain A, Geranylgeranyl Pyrophosphate Synthase Length = 340 Back     alignment and structure
>gi|157831115|pdb|1FPS|A Chain A, Crystal Structure Of Recombinant Farnesyl Diphosphate Synthase At 2.6 Angstroms Resolution Length = 348 Back     alignment and structure
>gi|157834060|pdb|1UBX|A Chain A, Structure Of Farnesyl Pyrophosphate Synthetase Length = 367 Back     alignment and structure
>gi|157834058|pdb|1UBV|A Chain A, Structure Of Farnesyl Pyrophosphate Synthetase Length = 367 Back     alignment and structure
>gi|126030919|pdb|2J1O|A Chain A, Geranylgeranyl Diphosphate Synthase From Sinapis Alba Length = 268 Back     alignment and structure
>gi|126030920|pdb|2J1P|A Chain A, Geranylgeranyl Diphosphate Synthase From Sinapis Alba In Complex With Ggpp Length = 293 Back     alignment and structure
>gi|290790316|pdb|3LVS|A Chain A, Crystal Structure Of Farnesyl Diphosphate Synthase From Rhodobacter Capsulatus Sb1003 Length = 298 Back     alignment and structure
>gi|310943001|pdb|3P8L|A Chain A, Crystal Structure Of Polyprenyl Synthase From Enterococcus Faecalis V583 Length = 302 Back     alignment and structure
>gi|90109651|pdb|2FTZ|A Chain A, Crystal Structure Of Geranyltranstransferase (Ec 2.5.1.10) (Tm0161) From Thermotoga Maritima At 1.90 A Resolution Length = 284 Back     alignment and structure
>gi|292659743|pdb|3LLW|A Chain A, Crystal Structure Of Geranyltransferase From Helicobacter Pylori 26695 Length = 311 Back     alignment and structure
>gi|317455530|pdb|3Q1O|A Chain A, Crystal Structure Of Geranyltransferase From Helicobacter Pylori Complexed With Magnesium And Isoprenyl Diphosphate Length = 310 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target322 octaprenyl-diphosphate synthase protein [Candidatus Lib
3mzv_A341 Decaprenyl diphosphate synthase; transferase, structura 4e-77
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl synthas 1e-76
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 3e-76
3n3d_A335 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 2e-69
3aqb_B325 Component B of hexaprenyl diphosphate synthase; prenylt 7e-68
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural genom 1e-55
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphosphate sy 7e-47
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosphonate 3e-42
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltransfer 6e-40
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosphate s 9e-39
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; structural gen 1e-37
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, isopre 8e-37
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesyl dip 3e-35
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, prenyl dip 2e-30
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoid pat 3e-30
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltransfer 2e-29
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, helical 3e-29
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyltrans 2e-28
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosphate s 1e-62
2ihi_A395 Pyrophosphate synthase; PV092040, structural genomics, 7e-39
3lom_A313 Geranyltranstransferase; geranyltransferase, structural 9e-57
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, structural 1e-50
3llw_A311 Geranyltranstransferase (ISPA); structural genomics, PS 1e-49
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, structural 3e-49
3lsn_A304 Geranyltranstransferase; structural genomics, protein s 6e-49
3lji_A304 Geranyltranstransferase; structural genomics, protein s 5e-47
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SGX, st 4e-46
3m0g_A297 Farnesyl diphosphate synthase; structural genomics, pro 3e-44
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aureus} 9e-29
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl synt 1e-27
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transferase, i 1e-27
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, trans- 1e-25
2ftz_A284 Geranyltranstransferase; TM0161, structural genomics, j 3e-22
3kra_B274 Geranyl diphosphate synthase small subunit; prenyltrans 1e-46
2h8o_A335 Geranyltranstransferase; geranyltransferase,agrobacteri 2e-36
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Length = 341 Back     alignment and structure
 Score =  283 bits (725), Expect = 4e-77
 Identities = 145/319 (45%), Positives = 203/319 (63%), Gaps = 1/319 (0%)

Query: 4   LEDLTLKDMEKVNFLILKRICSD-VEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGD 62
           L     +DM  VN LI +R+ S+    IP+V  +LI +GGKRLRPMLTLA A ++ Y G 
Sbjct: 14  LAQALAEDMAAVNALIRERMSSEHAPRIPEVTAHLIEAGGKRLRPMLTLAAARLVGYGGP 73

Query: 63  NHVLLACAIEFIHTATLLHDDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVI 122
            HV LA  +EFIHTATLLHDDVVD+S  RRG+  A L+W N++SVLVGD+L +++F ++ 
Sbjct: 74  FHVHLAATVEFIHTATLLHDDVVDESRQRRGRPTANLLWDNKSSVLVGDYLFARSFQLMT 133

Query: 123 ETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDYLHVIKSKTAVLFSAALEVSSL 182
           +T +   +E L+  +  +AEGE+ QL+ ++NL  TE+ YL VI+ KTA LFSAA EV  +
Sbjct: 134 DTGNMRVMEILANASAVIAEGEVLQLTAAQNLATTEDIYLRVIRGKTAALFSAATEVGGI 193

Query: 183 IAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILAF 242
           I G      QAL  YG  LGIAFQ+VDD+LDY G+  E+GKN G+DFR  K T+PVI A 
Sbjct: 194 IGGAPEDQVQALFDYGDALGIAFQIVDDLLDYGGKSAEIGKNTGDDFRERKLTMPVIKAV 253

Query: 243 QRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLP 302
               + E+ FWK  I  G     +L+ A  +M ++  L  T   A  +   A+ +L  LP
Sbjct: 254 ALADEAERAFWKRVIEKGDQQDGDLEHAMALMTKHGTLEATRLAAIGWTDTARKALAKLP 313

Query: 303 DSSWKKSLMEVVDFCLQRL 321
           D   ++ L ++ D+ ++R+
Sbjct: 314 DHPLRQMLDDLADYVVERV 332


>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Length = 345 Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} Length = 360 Back     alignment and structure
>3n3d_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.40A {Lactobacillus brevis} Length = 335 Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Length = 325 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative; 1.90A {Corynebacterium glutamicum} Length = 380 Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Length = 309 Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Length = 390 Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural genomics consortium, SGC; HET: RIS; 1.80A {Homo sapiens} PDB: 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 2f94_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* Length = 374 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl allyl pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* Length = 362 Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.20A {Pyrococcus horikoshii OT3} Length = 342 Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genomics; 1.55A {Thermus thermophilus HB8} Length = 330 Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural genomics, structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Length = 340 Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Length = 295 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Length = 299 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Length = 352 Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Length = 313 Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Length = 302 Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} Length = 311 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Length = 302 Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* Length = 304 Back     alignment and structure
>3lji_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.39A {Pseudomonas fluorescens} Length = 304 Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Length = 291 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, isoprene biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Length = 297 Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Length = 299 Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A Length = 293 Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Length = 289 Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima MSB8} Length = 284 Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* Length = 274 Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural genomics, PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens str} Length = 335 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target322 octaprenyl-diphosphate synthase protein [Candidatus Lib
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl synthas 100.0
3mzv_A341 Decaprenyl diphosphate synthase; transferase, structura 100.0
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 100.0
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; structural gen 100.0
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosphate s 100.0
3aqb_B325 Component B of hexaprenyl diphosphate synthase; prenylt 100.0
3n3d_A335 Geranylgeranyl pyrophosphate synthase; isoprenyl diphos 100.0
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural genom 100.0
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, prenyl dip 100.0
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoid pat 100.0
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltransfer 100.0
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltransfer 100.0
2ihi_A395 Pyrophosphate synthase; PV092040, structural genomics, 100.0
2h8o_A335 Geranyltranstransferase; geranyltransferase,agrobacteri 100.0
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyltrans 100.0
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aureus} 100.0
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl synt 100.0
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, helical 100.0
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphosphate sy 100.0
3lsn_A304 Geranyltranstransferase; structural genomics, protein s 100.0
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, structural 100.0
2ftz_A284 Geranyltranstransferase; TM0161, structural genomics, j 100.0
3lom_A313 Geranyltranstransferase; geranyltransferase, structural 100.0
3m0g_A297 Farnesyl diphosphate synthase; structural genomics, pro 100.0
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transferase, i 100.0
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, isopre 100.0
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosphate s 100.0
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosphonate 100.0
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesyl dip 100.0
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, structural 100.0
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, trans- 100.0
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SGX, st 100.0
3llw_A311 Geranyltranstransferase (ISPA); structural genomics, PS 100.0
3kra_B274 Geranyl diphosphate synthase small subunit; prenyltrans 100.0
1ezf_A340 Farnesyl-diphosphate farnesyltransferase; isoprenoid sy 97.61
2zco_A293 Dehydrosqualene synthase; CRTM, carotenoid biosynthesis 97.43
3kb9_A382 EPI-isozizaene synthase; terpenoid cyclase, alpha-helic 90.85
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
Probab=100.00  E-value=0  Score=571.80  Aligned_cols=321  Identities=47%  Similarity=0.733  Sum_probs=313.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             47999999999999999998607787589999999996798227999999999970898578666655789999999875
Q gi|254780755|r    2 KMLEDLTLKDMEKVNFLILKRICSDVEMIPDVVKYLIFSGGKRLRPMLTLATALMLEYRGDNHVLLACAIEFIHTATLLH   81 (322)
Q Consensus         2 ~~l~~~~~~~l~~v~~~i~~~~~~~~~~l~~~~~~~~~~gGKr~Rp~l~~l~~~~~~~~~~~~~~~a~~iEliH~asLiH   81 (322)
                      ..+..++..+|..|++.|.+.+.++.|++.++++|++.+||||+||+||+++++++|++.+.++++|+++|+||+|||||
T Consensus        25 ~~~~~~~~~d~~~v~~~i~~~l~s~~~~i~~~~~~~~~~gGKrlRp~l~l~~~~~~~~~~~~~~~~A~aiEliH~asLiH  104 (345)
T 3oyr_A           25 DRLVRLAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLRPLMTVAAARLAGADNDHFQKLAAAVEFIHTATLLH  104 (345)
T ss_dssp             HHHHHHTHHHHHHHHHHHHHHTCCSSTHHHHHHHHHHTTTCCCHHHHHHHHHHHHTTCCSSTHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999876882779999999874898517399999999981998789999999999999999986


Q ss_pred             HHHHCHHHHHHHCCCCHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             21101122001101210100110234312457888876421024311000123456777777545655421322103578
Q gi|254780755|r   82 DDVVDDSALRRGKVAARLVWGNQTSVLVGDFLLSQAFCMVIETKSQEALEALSLVACTLAEGELRQLSLSKNLDVTEEDY  161 (322)
Q Consensus        82 DDI~D~~~~RRg~~t~~~~~G~~~Ail~GD~l~~~a~~~l~~~~~~~~~~~~~~~~~~l~~Gq~~d~~~~~~~~~s~~~y  161 (322)
                      |||||+|+.|||+||+|.+||+++||++||||++++|..+++..+..+++.++++...+++||+.|.....+...++++|
T Consensus       105 DDi~D~~~~RRG~pt~~~~~G~~~Ail~GD~L~~~a~~~l~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~y  184 (345)
T 3oyr_A          105 DDVVDGSQLRRGKVAAHLIWGGAQSVLVGDFLFARAFELMVETNSMKALEILARASRVIAEGEVLQLMRSHDLNLSQAVY  184 (345)
T ss_dssp             TTTC---------CCCSCCTTHHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHHHHHTSSCSSCCHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHH
T ss_conf             87778875667998857366842888999999999887544111068899999999999731068877622777668999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCHH
Q ss_conf             98998643355554432100011222210157999997311168988764112367000384012345421365321001
Q gi|254780755|r  162 LHVIKSKTAVLFSAALEVSSLIAGVQNSVRQALKSYGMNLGIAFQLVDDVLDYRGEVNEMGKNIGEDFRNGKPTLPVILA  241 (322)
Q Consensus       162 ~~ii~~KTa~Lf~~~~~~ga~lag~~~~~~~~l~~fG~~lG~afQI~DD~ld~~g~~~~~GK~~g~Dl~egk~Tlpii~a  241 (322)
                      ++|+.+|||+||+++|.+|++++|++++..+.+.+||+++|+||||+||++|++|+++.+|||.|+||++||+|||++++
T Consensus       185 l~ii~~KTa~L~~~~~~~ga~~~~~~~~~~~~l~~~G~~lG~AFQI~DDllD~~~~~~~~GK~~g~Dl~egk~Tlp~i~a  264 (345)
T 3oyr_A          185 LEIIQAKTAELFAAASEAGAVSAGVDVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAGDDFREGKATLPLLLA  264 (345)
T ss_dssp             HHHHHHHTHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHTTC-------------------CCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCHHHCCCCCHHHHHH
T ss_conf             99999987489999998799883799999999998889999999998765413434676277754235249722999999


Q ss_pred             HHCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             10143110001343203689998999999999997496999999999999999998420899989999999999996037
Q gi|254780755|r  242 FQRGTKREKNFWKSTINDGKISVENLKKAFIIMRENRALVDTEYRAYSYGQKAKDSLRCLPDSSWKKSLMEVVDFCLQRL  321 (322)
Q Consensus       242 l~~~~~~~~~~l~~~~~~~~~~~~~~~~i~~ll~~~gai~~~~~~~~~~~~~A~~~L~~lp~~~~k~~L~~L~~~ii~R~  321 (322)
                      +++.++.+++.+..+++++..+++++++++++++++|++++++++++.|.++|+++|+.||+++.|+.|.+|++|+++|.
T Consensus       265 le~~~~~~~~~l~~~~~~~~~~~~~~~~i~~lv~~~g~i~~a~~~a~~~~~~A~~~L~~lp~s~~k~~L~~L~~~~~~Rk  344 (345)
T 3oyr_A          265 IARSGPREAEFWERAIGRREQTEADFRRARELIIGSGALDATLDLAADYADKAKAALAMFPANDWREALEELADFAVSRR  344 (345)
T ss_dssp             HHHSCSHHHHHHHHHCC----CCSSHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHTTTTSCSSHHHHHHHHHHHHHHHC-
T ss_pred             HHHCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             98699999999999873767999999999999998698999999999999999999866999889999999999998748


Q ss_pred             C
Q ss_conf             9
Q gi|254780755|r  322 N  322 (322)
Q Consensus       322 ~  322 (322)
                      |
T Consensus       345 s  345 (345)
T 3oyr_A          345 A  345 (345)
T ss_dssp             -
T ss_pred             C
T ss_conf             9



>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferase; 2.20A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>3n3d_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.40A {Lactobacillus brevis} Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative; 1.90A {Corynebacterium glutamicum} Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genomics; 1.55A {Thermus thermophilus HB8} Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural genomics, structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural genomics consortium, SGC; HET: RIS; 1.80A {Homo sapiens} PDB: 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* 3n1w_F* 3n3l_F* 2f94_F* ... Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural genomics, PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima MSB8} Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, isoprene biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl allyl pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure