254780764

254780764

hypothetical protein CLIBASIA_03275

GeneID in NCBI database:8209770Locus tag:CLIBASIA_03275
Protein GI in NCBI database:254780764Protein Accession:YP_003065177.1
Gene range:-(498335, 498919)Protein Length:194aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK
ccccHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEccEEEEEcccccccEEEEEEcccccEEEEEEEcccEEEEEEccccEEEEEHHHccccccEEEEcccccccccccEEEEcccccccEEEEEEccccEEEEEEEcccEEEEEEccEEEEEEcHHEEcccHHHccc
ccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccEEEEEEcccEEEEccccccccEEEEEEcccccEEEEEEcccEEEEEccccccEEEEEEcccccEEEEEEccccccccccEEEEcccccccccEEEEEccccEEEEEEccccEEEEEEcccEEEEEccEEEccccccccc
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILalshekeifekkplprfvtikasransrigpgiMYTVVCTYLTKGLPVEVVKEYENWRQirdfdgtiGWINKSllsgkrsaivspwnrktnnpiyinlykkpdiqsiIVAKVEPGVLLTIREcsgewcfgynldtegwikkqkiwgiypgevfk
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKasransrigpgiMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLlsgkrsaivspwnrktnnpIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLdtegwikkqkiwgiypgevfk
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK
*********YSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHE*****KKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIY********IQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVF*
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGE***
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK
MFTHAEKILYSLDLRKYMPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target194 hypothetical protein CLIBASIA_03275 [Candidatus Liberib
315121981177 hypothetical protein CKC_01155 [Candidatus Liberibacter 1 8e-70
327192784179 hypothetical protein RHECNPAF_1930010 [Rhizobium etli C 1 2e-45
190889806179 hypothetical protein RHECIAT_CH0000174 [Rhizobium etli 1 2e-45
241207089179 hypothetical protein Rleg_4408 [Rhizobium leguminosarum 1 1e-44
116249911179 hypothetical protein RL0144 [Rhizobium leguminosarum bv 1 4e-44
86355796179 hypothetical protein RHE_CH00136 [Rhizobium etli CFN 42 1 1e-43
218662759194 hypothetical protein RetlI_26864 [Rhizobium etli IE4771 1 3e-43
150398568183 hypothetical protein Smed_3379 [Sinorhizobium medicae W 1 3e-43
222084348179 hypothetical protein Arad_0203 [Agrobacterium radiobact 1 6e-43
227824000215 hypothetical protein NGR_c34960 [Sinorhizobium fredii N 1 7e-43
>gi|315121981|ref|YP_004062470.1| hypothetical protein CKC_01155 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 177 Back     alignment and organism information
 Score =  266 bits (681), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 127/177 (71%), Positives = 147/177 (83%)

Query: 18  MPKILQNSLIFTLAIYFYLAPILALSHEKEIFEKKPLPRFVTIKASRANSRIGPGIMYTV 77
           M +I     I TLAIYFY+      S E EI +K+ +PRFVTIK++RAN+RIGPG +YTV
Sbjct: 1   MSRISHIFFISTLAIYFYVVQAPIFSQEVEISKKQLIPRFVTIKSNRANARIGPGTIYTV 60

Query: 78  VCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSGKRSAIVSPWNRKTNNPIYIN 137
           VCTYL +GLPVE+++EYENWRQIRD DGT GWINK LLS KRSAIVSPWNRK  N  YI+
Sbjct: 61  VCTYLIRGLPVEIIQEYENWRQIRDVDGTTGWINKILLSNKRSAIVSPWNRKEKNRPYID 120

Query: 138 LYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGIYPGEVFK 194
           L++KP+ QSI+VAKVEPGVLLTIRECSGEWCFGYN D EGWIK++KIWGIYPGEVFK
Sbjct: 121 LHQKPETQSIVVAKVEPGVLLTIRECSGEWCFGYNSDVEGWIKQKKIWGIYPGEVFK 177


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327192784|gb|EGE59713.1| hypothetical protein RHECNPAF_1930010 [Rhizobium etli CNPAF512] Length = 179 Back     alignment and organism information
>gi|190889806|ref|YP_001976348.1| hypothetical protein RHECIAT_CH0000174 [Rhizobium etli CIAT 652] Length = 179 Back     alignment and organism information
>gi|241207089|ref|YP_002978185.1| hypothetical protein Rleg_4408 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 179 Back     alignment and organism information
>gi|116249911|ref|YP_765749.1| hypothetical protein RL0144 [Rhizobium leguminosarum bv. viciae 3841] Length = 179 Back     alignment and organism information
>gi|86355796|ref|YP_467688.1| hypothetical protein RHE_CH00136 [Rhizobium etli CFN 42] Length = 179 Back     alignment and organism information
>gi|218662759|ref|ZP_03518689.1| hypothetical protein RetlI_26864 [Rhizobium etli IE4771] Length = 194 Back     alignment and organism information
>gi|150398568|ref|YP_001329035.1| hypothetical protein Smed_3379 [Sinorhizobium medicae WSM419] Length = 183 Back     alignment and organism information
>gi|222084348|ref|YP_002542877.1| hypothetical protein Arad_0203 [Agrobacterium radiobacter K84] Length = 179 Back     alignment and organism information
>gi|227824000|ref|YP_002827973.1| hypothetical protein NGR_c34960 [Sinorhizobium fredii NGR234] Length = 215 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target194 hypothetical protein CLIBASIA_03275 [Candidatus Liberib
pfam0634755 pfam06347, SH3_4, Bacterial SH3 domain 4e-10
pfam0634755 pfam06347, SH3_4, Bacterial SH3 domain 3e-08
COG3807171 COG3807, COG3807, Uncharacterized protein conserved in 4e-47
>gnl|CDD|115031 pfam06347, SH3_4, Bacterial SH3 domain Back     alignment and domain information
>gnl|CDD|115031 pfam06347, SH3_4, Bacterial SH3 domain Back     alignment and domain information
>gnl|CDD|33601 COG3807, COG3807, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 194 hypothetical protein CLIBASIA_03275 [Candidatus Liberib
COG3807171 Uncharacterized protein conserved in bacteria [Function 100.0
COG3103205 SH3 domain protein [Signal transduction mechanisms] 99.73
KOG1428 3738 consensus 93.49
pfam0634755 SH3_4 Bacterial SH3 domain. This family consists of sev 99.48
pfam0823952 SH3_3 Bacterial SH3 domain. 99.38
smart0028763 SH3b Bacterial SH3 domain homologues. 99.04
COG3103 205 SH3 domain protein [Signal transduction mechanisms] 98.66
PRK10884 206 putative signal transduction protein; Provisional 98.57
COG4991155 Uncharacterized protein with a bacterial SH3 domain hom 98.47
COG3807171 Uncharacterized protein conserved in bacteria [Function 97.34
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 96.97
pfam0846065 SH3_5 Bacterial SH3 domain. 96.39
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) domain 95.5
pfam0765353 SH3_2 Variant SH3 domain. SH3 (Src homology 3) domains 95.41
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to proline 94.94
KOG0515752 consensus 91.46
smart0028763 SH3b Bacterial SH3 domain homologues. 99.17
PRK10884206 putative signal transduction protein; Provisional 99.15
pfam0823952 SH3_3 Bacterial SH3 domain. 99.06
pfam0634755 SH3_4 Bacterial SH3 domain. This family consists of sev 99.01
COG4991155 Uncharacterized protein with a bacterial SH3 domain hom 98.56
PRK13545549 tagH teichoic acids export protein ATP-binding subunit; 97.44
KOG4278 1157 consensus 93.14
PRK13914 475 invasion associated secreted endopeptidase; Provisional 91.95
pfam0846065 SH3_5 Bacterial SH3 domain. 91.59
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) domain 91.09
KOG4226 379 consensus 97.37
KOG4226 379 consensus 95.86
>COG3807 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3103 SH3 domain protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1428 consensus Back     alignment and domain information
>pfam06347 SH3_4 Bacterial SH3 domain Back     alignment and domain information
>pfam08239 SH3_3 Bacterial SH3 domain Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>COG3103 SH3 domain protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10884 putative signal transduction protein; Provisional Back     alignment and domain information
>COG4991 Uncharacterized protein with a bacterial SH3 domain homologue [Function unknown] Back     alignment and domain information
>COG3807 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>pfam08460 SH3_5 Bacterial SH3 domain Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>pfam07653 SH3_2 Variant SH3 domain Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG0515 consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>PRK10884 putative signal transduction protein; Provisional Back     alignment and domain information
>pfam08239 SH3_3 Bacterial SH3 domain Back     alignment and domain information
>pfam06347 SH3_4 Bacterial SH3 domain Back     alignment and domain information
>COG4991 Uncharacterized protein with a bacterial SH3 domain homologue [Function unknown] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>KOG4278 consensus Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>pfam08460 SH3_5 Bacterial SH3 domain Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG4226 consensus Back     alignment and domain information
>KOG4226 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target194 hypothetical protein CLIBASIA_03275 [Candidatus Liberib
2krs_A74 Solution Nmr Structure Of Sh3 Domain From Cpf_0587 4e-06
2kq8_A70 Solution Nmr Structure Of A Domain From Bt9727_4915 6e-05
2kt8_A76 Solution Nmr Structure Of The Cpe1231(468-535) Prot 8e-05
2kyb_A60 Solution Structure Of Cpr82g From Clostridium Perfr 3e-04
>gi|284793776|pdb|2KRS|A Chain A, Solution Nmr Structure Of Sh3 Domain From Cpf_0587 (Fragment 415-479) From Clostridium Perfringens. Northeast Structural Genomics Consortium (Nesg) Target Cpr74a Length = 74 Back     alignment and structure
 Score = 55.3 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 15/59 (25%)

Query: 126 WNRKTNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKI 184
                     +N+   P     ++  +     + I +    W         G+  K  I
Sbjct: 1   MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYI 59


>gi|284793773|pdb|2KQ8|A Chain A, Solution Nmr Structure Of A Domain From Bt9727_4915 From Bacillus Thuringiensis, Northeast Structural Genomics Consortium Target Bur95a Length = 70 Back     alignment and structure
>gi|285803120|pdb|2KT8|A Chain A, Solution Nmr Structure Of The Cpe1231(468-535) Protein From Clostridium Perfringens, Northeast Structural Genomics Consortium Target Cpr82b Length = 76 Back     alignment and structure
>gi|297787506|pdb|2KYB|A Chain A, Solution Structure Of Cpr82g From Clostridium Perfringens. N Structural Genomics Consortium Target Cpr82g Length = 60 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target194 hypothetical protein CLIBASIA_03275 [Candidatus Liberib
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, PSI, 5e-09
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CP 1e-07
2kt8_A76 Probable surface protein; SH3 family, structural genomi 2e-07
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CP 0.002
2kt8_A76 Probable surface protein; SH3 family, structural genomi 0.001
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Length = 70 Back     alignment and structure
 Score = 56.3 bits (136), Expect = 5e-09
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 58  VTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLS 116
             I AS  N R G G  Y ++   L +G  V+V+ E   W +I  ++G  G+I    LS
Sbjct: 5   YYINASALNVRSGEGTNYRII-GALPQGQKVQVISENSGWSKIN-YNGQTGYIGTRYLS 61


>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Length = 74 Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} Length = 76 Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Length = 74 Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} Length = 76 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target194 hypothetical protein CLIBASIA_03275 [Candidatus Liberib
2kt8_A76 Probable surface protein; SH3 family, structural genomi 99.4
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CP 99.37
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, PSI, 99.31
1xov_A326 PLY protein, plypsa; alpha/beta hydrolase, multi-domain 98.0
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal transdu 97.64
2hbw_A 235 NLP/P60 protein; YP_323898.1, structural genomics, PSI- 97.6
3m1u_A 434 Putative gamma-D-glutamyl-L-diamino acid endopeptidase; 96.3
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken structura 96.12
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, 96.07
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, dupli 95.94
2d1x_A66 Cortactin isoform A; SH3, complex, cell invasion; 1.90A 95.93
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structural pr 95.92
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, solution st 95.92
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken 95.89
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, , str 95.89
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucleotid 95.89
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five anti 95.86
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P4 95.85
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, CIN85 95.82
1uti_A58 GRB2-related adaptor protein 2; signaling protein regul 95.79
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-binding pro 95.79
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 95.79
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domain, st 95.77
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, structural 95.77
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken structura 95.74
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, 95.74
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; structu 95.73
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nuclear pr 95.73
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated calcium 95.72
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle protein 95.71
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, signaling 95.68
1uj0_A62 Signal transducing adaptor molecule (SH3 domain and ITA 95.68
2vwf_A58 Growth factor receptor-bound protein 2; polymorphism, p 95.67
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyr 95.63
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural genom 95.63
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain, hum 95.63
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear 95.59
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesion; 1 95.59
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1 95.5
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, structu 95.5
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 domain, p 95.48
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 domain, C 95.47
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structural gen 95.4
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis regu 95.37
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Saccharom 95.34
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor prote 95.32
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, sign 95.32
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CIN85, 95.31
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type t 95.3
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-glutam 95.29
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homology 3, 95.28
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, alte 95.27
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cytoplas 95.26
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 0 DAY 95.18
2yun_A79 Nostrin; nitric oxide synthase trafficker, structural g 95.18
2dil_A69 Proline-serine-threonine phosphatase-interacting protei 95.18
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain, str 95.16
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structural gen 95.13
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 intergenic r 95.11
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled coil, 95.07
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, s 95.03
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domain, KI 95.02
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchang 94.98
1r77_A103 Cell WALL targeting domain of glycylglycine endopeptida 94.98
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide co 94.96
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 domain 94.95
2j6f_A62 CD2-associated protein; metal-binding, UBL conjugation, 94.9
2l0a_A72 STAM-1, signal transducing adapter molecule 1; structur 94.88
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 dom 94.87
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin, C-C 94.82
1ujy_A76 RHO guanine nucleotide exchange factor 6; structural ge 94.78
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural genomi 94.76
2fei_A65 CD2-associated protein; CMS SH3 domain, structural prot 94.74
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, structural 94.71
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, cytopl 94.7
2rqr_A119 CED-12 homolog, engulfment and cell motility protein 1, 94.69
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-barrel 94.65
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; MAP3 94.64
1i07_A60 Epidermal growth factor receptor kinase substrate EPS8; 94.61
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domain, ty 94.6
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domain, be 94.56
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activator; 94.55
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, national 94.53
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, structural 94.44
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 94.43
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibit 94.38
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH 94.36
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-binding, 94.36
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signaling pro 94.3
1ri9_A102 FYN-binding protein; SH3-like, helically extended, sign 94.29
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocytosis 94.21
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-inhibi 94.14
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-through 94.11
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide exchange f 94.07
2cuc_A70 SH3 domain containing ring finger 2; structural genomic 94.0
1u3o_A82 Huntingtin-associated protein-interacting protein; SH3, 94.0
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, neuro 93.95
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A {Sac 93.94
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo s 93.87
2da9_A70 SH3-domain kinase binding protein 1; structural genomic 93.79
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 1.39 93.61
2d8j_A77 FYN-related kinase; SH3 domain, structural genomics, NP 93.61
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, SH3KB 93.6
2ct4_A70 CDC42-interacting protein 4; thyroid receptor interacti 93.59
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein complex 93.56
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene protein/ 93.55
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FYN; be 93.5
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown funct 93.49
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase 93.49
2vkn_A70 Protein SSU81; peptide, membrane, SH3 domain, transmemb 93.32
2v1r_A80 Peroxisomal membrane protein PAS20; protein transport, 93.16
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-related 93.14
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycoprotei 93.1
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; struc 93.09
1wxb_A68 Epidermal growth factor receptor pathway substrate 8-li 93.03
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-binding- 93.0
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, struc 92.93
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylation, 92.93
2j05_A65 RAS GTPase-activating protein 1; GTPase activation, SH3 92.74
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta barrel 92.71
3i35_A60 LAsp-1, MLN 50, LIM and SH3 domain protein 1; beta-barr 92.71
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel, GRA 92.69
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; scaf 92.61
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapie 92.56
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 2-lik 92.48
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapi 92.38
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken structura 92.26
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR {Mus m 92.16
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; SRC- 92.14
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, beta 91.96
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transport, st 91.94
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodiestera 91.89
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, natio 91.88
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domain, KI 91.49
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural genomic 91.42
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, structural 91.27
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, struc 91.25
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, 90.93
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14 90.54
2x3w_D60 Syndapin I, protein kinase C and casein kinase substrat 90.4
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; MATK, 90.01
3h41_A 311 NLP/P60 family protein; NP_979181.1, NLPC/P60 family pr 99.11
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, 98.43
1xov_A326 PLY protein, plypsa; alpha/beta hydrolase, multi-domain 98.25
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH 97.91
3m1u_A 434 Putative gamma-D-glutamyl-L-diamino acid endopeptidase; 97.86
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domains, s 97.4
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domains, s 96.41
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, 94.65
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CP 99.11
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, PSI, 99.08
2kt8_A76 Probable surface protein; SH3 family, structural genomi 99.04
2hbw_A235 NLP/P60 protein; YP_323898.1, structural genomics, PSI- 98.26
3h41_A311 NLP/P60 family protein; NP_979181.1, NLPC/P60 family pr 97.51
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-inhibi 96.12
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobulin G 96.03
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, hypo 95.9
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical bundl 95.72
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosis, st 95.57
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, 94.93
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, 94.81
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein-prot 94.52
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimera; SP 94.46
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine k 93.97
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylation, 93.87
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, NPPS 93.5
1lck_A175 P56==LCK== tyrosine kinase; complex (kinase/peptide); H 93.46
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE 93.34
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cytoplas 93.28
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal transdu 93.13
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL 92.94
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 3, SH 92.88
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural genomi 92.8
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- length enr 92.79
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled coil, 92.33
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protein bin 91.71
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signaling pro 91.55
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 domain, 91.48
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P, rox 91.14
1ri9_A102 FYN-binding protein; SH3-like, helically extended, sign 91.1
1i07_A60 Epidermal growth factor receptor kinase substrate EPS8; 90.99
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, 90.34
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type t 90.19
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein; NMR 90.02
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
Probab=99.40  E-value=9e-13  Score=95.80  Aligned_cols=58  Identities=17%  Similarity=0.187  Sum_probs=52.0

Q ss_pred             CCCCCCEEEECCCCCCCCEEEEECCCCEEEEEEEECCEEEEEECCEEEEEECCCEEEE
Q ss_conf             3443311333179987753799738988999952099899998998999971412205
Q gi|254780764|r  130 TNNPIYINLYKKPDIQSIIVAKVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIWGI  187 (194)
Q Consensus       130 ~~~~~~lnvR~~Ps~~s~iv~~l~~g~~v~i~~~~~~W~kV~~~g~~GWV~k~~iwGv  187 (194)
                      +.+++.||||++|++++++++++++|+.+.++++.++||+|+++|.+|||+++||--+
T Consensus         7 V~t~~~lNvR~~Ps~~s~iv~~l~~g~~v~v~~~~~~W~kV~~~g~~GwV~~~yl~~~   64 (76)
T 2kt8_A            7 VNVSSSLNVREGASTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYIKDI   64 (76)
T ss_dssp             ECCSSCEEEESSSSTTSCEEEEECTTCEEEEEEEETTEEEEEETTEEEEEEGGGEEEE
T ss_pred             EEECCCEEEECCCCCCCHHHEEECCCCEEEEEEEECCEEEEEECCEEEEEEHHHCCCC
T ss_conf             9929979997999999879999979999999999899999998998999997981817



>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1xov_A PLY protein, plypsa; alpha/beta hydrolase, multi-domain; 1.80A {Listeria phage psa} SCOP: b.34.11.4 c.56.5.6 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2hbw_A NLP/P60 protein; YP_323898.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics; HET: UNL; 1.05A {Anabaena variabilis atcc 29413} PDB: 2evr_A 2fg0_A Back     alignment and structure
>3m1u_A Putative gamma-D-glutamyl-L-diamino acid endopeptidase; structural genomics, joint center for structural genomics, JCSG; HET: MSE MES; 1.75A {Desulfovibrio vulgaris} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2d1x_A Cortactin isoform A; SH3, complex, cell invasion; 1.90A {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 2f2x_A 1qkw_A 1qkx_A ... Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2pqh_A Spectrin alpha chain, brain; SH3 domain, chimera, , structural protein; 1.75A {Gallus gallus} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, chromosomal rearrangement, coiled coil, cytoplasm, endosome lipid-binding; 1.70A {Rattus norvegicus} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2js0_A 2frw_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, alternative splicing, apoptosis, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, alternative splicing, ATP-binding, cell adhesion, chromosomal rearrangement, cytoplasm; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1r77_A Cell WALL targeting domain of glycylglycine endopeptidase ALE-1; SH3B domain, lysostaphin, peptidoglycan hydrolase; 1.75A {Staphylococcus capitis} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, UBL conjugation, immune response, SH3, zinc, calcium, SH2 domain, SH3 domain, zinc-finger; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3hck_A 1bu1_A Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2k6d_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; peptide, membrane, SH3 domain, transmembrane, membrane protein; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide complex, structural genomics, membrane, transport, SH3 domain; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>3i35_A LAsp-1, MLN 50, LIM and SH3 domain protein 1; beta-barrel, structural genomics, structural genomics consortium, SGC, acetylation, actin-binding; 1.40A {Homo sapiens} PDB: 1ark_A 1neb_A Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1; 3.00A {Rattus norvegicus} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in neurons protein 1; endocytosis, phosphoprotein, BAR, N-WAsp, dynamin, pacsin I; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h41_A NLP/P60 family protein; NP_979181.1, NLPC/P60 family protein, structural genomics, joint center for structural genomics, JCSG; HET: DGL PG4; 1.79A {Bacillus cereus atcc 10987} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoreductase activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1xov_A PLY protein, plypsa; alpha/beta hydrolase, multi-domain; 1.80A {Listeria phage psa} SCOP: b.34.11.4 c.56.5.6 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2ggr_A Back     alignment and structure
>3m1u_A Putative gamma-D-glutamyl-L-diamino acid endopeptidase; structural genomics, joint center for structural genomics, JCSG; HET: MSE MES; 1.75A {Desulfovibrio vulgaris} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2hbw_A NLP/P60 protein; YP_323898.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics; HET: UNL; 1.05A {Anabaena variabilis atcc 29413} PDB: 2evr_A 2fg0_A Back     alignment and structure
>3h41_A NLP/P60 family protein; NP_979181.1, NLPC/P60 family protein, structural genomics, joint center for structural genomics, JCSG; HET: DGL PG4; 1.79A {Bacillus cereus atcc 10987} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3hck_A 1bu1_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protein; 2.25A {Homo sapiens} PDB: 2dx1_A Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoreductase activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 1yoj_A 1yom_A* 3dqw_A* 3g6h_A* ... Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1lck_A P56==LCK== tyrosine kinase; complex (kinase/peptide); HET: PTR; 2.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 PDB: 1x27_A* Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target194 hypothetical protein CLIBASIA_03275 [Candidatus Liberib
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 96.19
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- and C 96.1
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 96.07
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [Ta 96.05
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse (Mus m 95.84
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus 95.8
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- and C 95.74
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 95.58
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [ 95.57
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Saccharomy 95.55
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Homo sap 95.48
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 95.47
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 95.38
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo 95.29
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 95.29
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} 95.14
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} 94.82
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId 94.69
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo sapien 94.61
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- and C 94.3
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} 94.11
d1m9sa386 Internalin B, C-terminal domains {Listeria monocytogene 93.93
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090 93.85
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [Tax 93.69
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast (Sac 93.38
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Human ( 93.3
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 93.23
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Homo sap 93.17
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Homo sap 93.0
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sapiens 92.91
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Saccharomyce 92.83
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 92.24
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 92.19
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens) [Ta 90.88
d1m9sa478 Internalin B, C-terminal domains {Listeria monocytogene 90.42
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Homo sap 95.89
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo 95.56
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 94.25
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.94
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} 92.19
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 90.2
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Intersectin 2 (KIAA1256)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.19  E-value=0.0012  Score=38.40  Aligned_cols=35  Identities=20%  Similarity=0.308  Sum_probs=26.4

Q ss_pred             EECCCCEEEEEEEECCEEEEEECCEEEEEECCCEE
Q ss_conf             97389889999520998999989989999714122
Q gi|254780764|r  151 KVEPGVLLTIRECSGEWCFGYNLDTEGWIKKQKIW  185 (194)
Q Consensus       151 ~l~~g~~v~i~~~~~~W~kV~~~g~~GWV~k~~iw  185 (194)
                      .+.+|+.+.|++.+++|++++.+|++|||..+||-
T Consensus        26 s~~~Gd~v~vl~~~~~Ww~~~~~g~~G~vP~~yv~   60 (69)
T d1uhfa_          26 TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVK   60 (69)
T ss_dssp             CBCTTCEEEECEEETTEEEECSTTCCEEECGGGCE
T ss_pred             CCCCCCEEEEEEECCCEEEEEECCCEEEECHHHEE
T ss_conf             79799999998854997999989918898166689



>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1m9sa3 b.34.11.1 (A:466-551) Internalin B, C-terminal domains {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9sa4 b.34.11.1 (A:552-629) Internalin B, C-terminal domains {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 194 hypothetical protein CLIBASIA_03275 [Candidatus Li
2kt8_A_76 (A:) Probable surface protein; SH3 family, structu 3e-09
2krs_A_74 (A:) Probable enterotoxin; all beta, SH3, ENTD, CP 8e-09
2kq8_A_70 (A:) Cell WALL hydrolase; GFT protein structure, N 1e-07
3h41_A_108-18477 (A:108-184) NLP/P60 family protein; NP_979181.1, N 2e-05
2kt8_A_76 (A:) Probable surface protein; SH3 family, structu 6e-04
2krs_A_74 (A:) Probable enterotoxin; all beta, SH3, ENTD, CP 0.001
2kq8_A_70 (A:) Cell WALL hydrolase; GFT protein structure, N 0.002
>2kt8_A (A:) Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens}Length = 76 Back     alignment and structure
 Score = 56.4 bits (136), Expect = 3e-09
 Identities = 13/70 (18%), Positives = 29/70 (41%), Gaps = 2/70 (2%)

Query: 58  VTIKASRANSRIGPGIMYTVVCTYLTKGLPVEVVKEYENWRQIRDFDGTIGWINKSLLSG 117
           +   +S  N R G      V+   L+    V +V E   + +I  + G+ G++ K  +  
Sbjct: 6   IVNVSSSLNVREGASTSSKVI-GSLSGNTKVTIVGEEGAFYKIE-YKGSHGYVAKEYIKD 63

Query: 118 KRSAIVSPWN 127
            +  ++   +
Sbjct: 64  IKDEVLEHHH 73


>2krs_A (A:) Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens}Length = 74 Back     alignment and structure
>2kq8_A (A:) Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian}Length = 70 Back     alignment and structure
>3h41_A (A:108-184) NLP/P60 family protein; NP_979181.1, NLPC/P60 family protein, structural genomics, joint center for structural genomics, JCSG; HET: DGL PG4; 1.79A {Bacillus cereus atcc 10987}Length = 77 Back     alignment and structure
>2kt8_A (A:) Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens}Length = 76 Back     alignment and structure
>2krs_A (A:) Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens}Length = 74 Back     alignment and structure
>2kq8_A (A:) Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian}Length = 70 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength