254780765

254780765

3-deoxy-manno-octulosonate cytidylyltransferase

GeneID in NCBI database:8209771Locus tag:CLIBASIA_03280
Protein GI in NCBI database:254780765Protein Accession:YP_003065178.1
Gene range:-(497362, 498168)Protein Length:268aa
Gene description:3-deoxy-manno-octulosonate cytidylyltransferase
COG prediction:[M] CMP-2-keto-3-deoxyoctulosonic acid synthetase
KEGG prediction:kdsB; 3-deoxy-manno-octulosonate cytidylyltransferase (EC:2.7.7.38); K00979 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC:2.7.7.38]
SEED prediction:3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MKDQHIKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKILKS
cccccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEcccHHHHcccccEEEEEEccccccccEEEEEEcccccccccccEEEEEEEEEcHHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcc
cccccccccEEEEEEccccccccccccccEEccEEHHHHHHHHHHHcccccEEEEccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHccccccEccccEEcccHHHcccccEEEEEEccccccccEEEEEEEcccccccccHEEEEEEEEEEEHHHHHHHccccccHHHHHHccccHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHccccccHHHHcHHHHcc
MKDQHIKEKVLVIIPArlnsmrfpkkiladinglpMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESvmthtshqsgsdRIFEALNiidsdkksQIIVNMqadipniepEILASVllplqnpivdigtlgtrihgstdpddpniVKIVVAspsengcfralyftrtktphgtgpfyqhlGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIvqsnamsvdttndLEKVrtliphdhhkglYKKIFNDKILKS
mkdqhikeKVLViiparlnsmrFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMthtshqsgsdRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIhgstdpddpNIVKIVVASPSENGCFRALYFTrtktphgtgpFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVkivqsnamsvdttndLEKVRTliphdhhkglykkifndkilks
MKDQHIKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKILKS
***********VIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPH*H*******IFNDKIL**
MKDQHIKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESV********GSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKILKS
*****IKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKIL*S
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDQHIKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKILKS
MKDQHIKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKILKS
MKDQHIKEKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTLIPHDHHKGLYKKIFNDKILKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target268 3-deoxy-manno-octulosonate cytidylyltransferase [Candid
315121982250 3-deoxy-manno-octulosonate cytidylyltransferase [Candid 1 1e-101
116249907251 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizob 1 2e-73
86355792251 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizob 1 1e-72
222147101276 3-deoxy-D-manno-octulosonate cytidylyltransferase [Agro 1 2e-72
209551655251 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizob 1 3e-72
222084342251 3-deoxy-manno-octulosonate cytidylyltransferase protein 1 9e-69
190889802251 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizob 1 1e-68
227824054263 3-deoxy-manno-octulosonate cytidylyltransferase [Sinorh 1 1e-68
218510327246 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizob 1 4e-68
241207085251 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizob 1 5e-68
>gi|315121982|ref|YP_004062471.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 250 Back     alignment and organism information
 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/247 (71%), Positives = 212/247 (85%), Gaps = 1/247 (0%)

Query: 8   EKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQ 67
           E VL+IIPAR+ S R P KILADING+PM+ HTAIRA+KANIGRVI+AVDD K +E++ +
Sbjct: 2   ENVLIIIPARIKSTRIPGKILADINGMPMLFHTAIRAQKANIGRVIIAVDDKKTSEVMSR 61

Query: 68  AGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNP 127
            GFE+++T+ SHQSGSDRIFEALN+IDS++K++IIVN+QADIPNIEPEILA+ LLPLQNP
Sbjct: 62  EGFETIITNASHQSGSDRIFEALNLIDSEQKAKIIVNVQADIPNIEPEILAATLLPLQNP 121

Query: 128 IVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHGTGPFYQHLGIY 187
           IVDIGT+ T IH S   DDPN+VKIV  SPS+N C R+LYFTR+K P+G GPFYQHLGIY
Sbjct: 122 IVDIGTIATEIHDSKGVDDPNVVKIVT-SPSKNECLRSLYFTRSKAPYGIGPFYQHLGIY 180

Query: 188 AYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQSNAMSVDTTNDLEKVRTL 247
           AYRREALK FTQL PS+LE+RESLEQLRALE  MRIDVK+VQSNA+SVDT +DL K R L
Sbjct: 181 AYRREALKHFTQLPPSILEKRESLEQLRALENGMRIDVKVVQSNAISVDTADDLAKARIL 240

Query: 248 IPHDHHK 254
           + H  ++
Sbjct: 241 MSHCRYE 247


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116249907|ref|YP_765745.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 251 Back     alignment and organism information
>gi|86355792|ref|YP_467684.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium etli CFN 42] Length = 251 Back     alignment and organism information
>gi|222147101|ref|YP_002548058.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Agrobacterium vitis S4] Length = 276 Back     alignment and organism information
>gi|209551655|ref|YP_002283572.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 251 Back     alignment and organism information
>gi|222084342|ref|YP_002542871.1| 3-deoxy-manno-octulosonate cytidylyltransferase protein [Agrobacterium radiobacter K84] Length = 251 Back     alignment and organism information
>gi|190889802|ref|YP_001976344.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium etli CIAT 652] Length = 251 Back     alignment and organism information
>gi|227824054|ref|YP_002828027.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sinorhizobium fredii NGR234] Length = 263 Back     alignment and organism information
>gi|218510327|ref|ZP_03508205.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium etli Brasil 5] Length = 246 Back     alignment and organism information
>gi|241207085|ref|YP_002978181.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 251 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target268 3-deoxy-manno-octulosonate cytidylyltransferase [Candid
PRK05450245 PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidyly 9e-84
COG1212247 COG1212, KdsB, CMP-2-keto-3-deoxyoctulosonic acid synth 4e-70
PRK13368238 PRK13368, PRK13368, 3-deoxy-manno-octulosonate cytidyly 2e-57
TIGR00466238 TIGR00466, kdsB, 3-deoxy-D-manno-octulosonate cytidylyl 2e-46
PLN02917293 PLN02917, PLN02917, CMP-KDO synthetase 2e-35
cd02517239 cd02517, CMP-KDO-Synthetase, CMP-KDO synthetase catalyz 4e-72
pfam02348197 pfam02348, CTP_transf_3, Cytidylyltransferase 5e-31
cd02518233 cd02518, GT2_SpsF, SpsF is a glycosyltrnasferase implic 6e-10
cd02513223 cd02513, CMP-NeuAc_Synthase, CMP-NeuAc_Synthase activat 3e-08
COG1861241 COG1861, SpsF, Spore coat polysaccharide biosynthesis p 6e-07
TIGR03584222 TIGR03584, PseF, pseudaminic acid CMP-transferase 3e-05
COG1083228 COG1083, NeuA, CMP-N-acetylneuraminic acid synthetase [ 3e-04
>gnl|CDD|180091 PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31405 COG1212, KdsB, CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|184007 PRK13368, PRK13368, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129558 TIGR00466, kdsB, 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|178505 PLN02917, PLN02917, CMP-KDO synthetase Back     alignment and domain information
>gnl|CDD|133010 cd02517, CMP-KDO-Synthetase, CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>gnl|CDD|145475 pfam02348, CTP_transf_3, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|133011 cd02518, GT2_SpsF, SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>gnl|CDD|133006 cd02513, CMP-NeuAc_Synthase, CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>gnl|CDD|32046 COG1861, SpsF, Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|163336 TIGR03584, PseF, pseudaminic acid CMP-transferase Back     alignment and domain information
>gnl|CDD|31280 COG1083, NeuA, CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 268 3-deoxy-manno-octulosonate cytidylyltransferase [Candid
PRK05450248 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 100.0
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the act 100.0
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cel 100.0
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 100.0
TIGR00466246 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase; 100.0
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acety 100.0
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated in th 100.0
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequences in 100.0
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envel 99.97
COG1861241 SpsF Spore coat polysaccharide biosynthesis protein F, 99.96
TIGR01173 461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.94
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU. The 99.9
COG1207 460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.88
PRK09451 456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.87
cd04189236 G1P_TT_long G1P_TT_long represents the long form of glu 99.81
TIGR01208 361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 99.79
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1P-gua 99.73
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a memb 99.72
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily of n 99.71
cd02538240 G1P_TT_short G1P_TT_short is the short form of glucose- 99.7
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses the syn 99.68
PRK00155228 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.67
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltransfe 99.66
pfam01128221 IspD Uncharacterized protein family UPF0007. 99.64
PRK05293 381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.62
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in the bi 99.62
COG1208 358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 99.61
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase catal 99.59
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a memb 99.58
COG2068199 Uncharacterized MobA-related protein [General function 99.57
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biog 99.57
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subunit Ga 99.55
PRK10122297 UTP--glucose-1-phosphate uridylyltransferase subunit Ga 99.54
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanyly 99.52
PRK13385238 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferas 99.52
pfam00483247 NTP_transferase Nucleotidyl transferase. This family in 99.52
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in meva 99.49
PRK09382 382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate 99.46
cd04181217 NTP_transferase NTP_transferases catalyze the transfer 99.46
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis protein 99.41
KOG1322 371 consensus 99.4
PRK02862 429 glgC glucose-1-phosphate adenylyltransferase; Provision 99.4
PRK00844 409 glgC glucose-1-phosphate adenylyltransferase; Provision 99.39
PRK01884 435 consensus 99.38
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase 99.35
TIGR00453226 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.3
PRK04928 405 consensus 99.28
PRK03282 406 consensus 99.27
PRK03701 431 consensus 99.27
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involve 99.15
PRK00725 431 glgC glucose-1-phosphate adenylyltransferase; Provision 99.09
COG1213239 Predicted sugar nucleotidyltransferases [Cell envelope 99.05
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope bioge 98.82
TIGR01099270 galU UTP-glucose-1-phosphate uridylyltransferase; Inter 98.8
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC. 98.71
COG0448 393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 98.7
TIGR02091 421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 98.6
pfam01983217 CofC Guanylyl transferase CofC like. Coenzyme F420 is a 98.42
TIGR02623256 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase; 97.44
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulose sy 97.05
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerization of 96.7
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (C 96.68
cd02520196 Glucosylceramide_synthase Glucosylceramide synthase cat 96.63
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase; InterPr 96.6
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the biosynthe 96.54
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the elong 96.2
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulose sy 95.99
TIGR03469384 HonB hopene-associated glycosyltransferase HpnB. This f 95.83
cd06442224 DPM1_like DPM1_like represents putative enzymes similar 95.17
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen 94.7
PRK11204 421 N-glycosyltransferase PgaC; Provisional 93.73
COG1215 439 Glycosyltransferases, probably involved in cell wall bi 93.1
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 92.84
PRK10714324 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose 91.74
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 91.69
TIGR03111 439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111. 91.39
pfam02348197 CTP_transf_3 Cytidylyltransferase. This family consists 100.0
KOG1460 407 consensus 98.35
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase 98.16
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Cell en 97.59
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopolysacch 96.26
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins 94.3
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protein, Yg 99.61
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthesis pr 99.54
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB. In 99.53
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis protein 99.53
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransferase [C 99.44
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glycosylt 99.39
cd02503181 MobA MobA catalyzes the formation of molybdopterin guan 99.27
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subunit o 99.24
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthesis pr 99.1
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like 99.02
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon subun 99.0
KOG1462 433 consensus 98.41
TIGR02665202 molyb_mobA molybdopterin-guanine dinucleotide biosynthe 98.3
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis protein 98.25
TIGR00454204 TIGR00454 conserved hypothetical protein TIGR00454; Int 98.24
COG4750231 LicC CTP:phosphocholine cytidylyltransferase involved i 97.82
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A 97.36
KOG1461 673 consensus 96.89
cd06438183 EpsO_like EpsO protein participates in the methanolan s 93.02
COG1920210 Predicted nucleotidyltransferase, CobY/MobA/RfbA family 97.59
cd06435236 CESA_NdvC_like NdvC_like proteins in this family are pu 95.47
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 91.35
cd04188211 DPG_synthase DPG_synthase is involved in protein N-link 95.35
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 gluco 94.1
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase; InterPro: IPR004528 3-Deoxy-D-manno-octulosonate cytidylyltransferase (2 Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>pfam01128 IspD Uncharacterized protein family UPF0007 Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>PRK10122 UTP--glucose-1-phosphate uridylyltransferase subunit GalF; Provisional Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>pfam00483 NTP_transferase Nucleotidyl transferase Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 The bacterial ispD protein catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase; InterPro: IPR005771 Uridine 5'-triphosphate:glucose-1-phosphate uridylyltransferase (uridine diphosphoglucose pyrophosphorylase, 2 Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>pfam01983 CofC Guanylyl transferase CofC like Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase; InterPro: IPR013446 Glucose-1-phosphate cytidylyltransferases, also known as CDP-glucose pyrophosphorylase, are the product of the rfbF gene and produce CDP-D-glucose Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase; InterPro: IPR005907 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>PRK11204 N-glycosyltransferase PgaC; Provisional Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>pfam02348 CTP_transf_3 Cytidylyltransferase Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein A; Reviewed Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A; InterPro: IPR013482 In many molybdopterin-containing enzymes, including nitrate reductase and dimethylsulphoxide reductase, the cofactor is molybdopterin-guanine dinucleotide Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR00454 TIGR00454 conserved hypothetical protein TIGR00454; InterPro: IPR005245 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>COG1920 Predicted nucleotidyltransferase, CobY/MobA/RfbA family [General function prediction only] Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target268 3-deoxy-manno-octulosonate cytidylyltransferase [Candid
3k8d_A264 Crystal Structure Of E. Coli Lipopolysaccharide Spe 5e-44
3oam_A252 Crystal Structure Of Cytidylyltransferase From Vibr 2e-43
1vic_A262 Crystal Structure Of Cmp-Kdo Synthetase Length = 26 9e-42
1vh1_A256 Crystal Structure Of Cmp-Kdo Synthetase Length = 25 8e-41
3duv_A262 Crystal Structure Of 3-Deoxy-Manno-Octulosonate Cyt 9e-40
1vh3_A262 Crystal Structure Of Cmp-Kdo Synthetase Length = 26 9e-40
1h6j_A245 The Three-Dimensional Structure Of Capsule-Specific 4e-39
3pol_A276 2.3 Angstrom Crystal Structure Of 3-Deoxy-Manno-Oct 2e-34
3jtj_A253 3-Deoxy-Manno-Octulosonate Cytidylyltransferase Fro 5e-34
1eyr_A228 Structure Of A Sialic Acid Activating Synthetase, C 5e-11
1qwj_A229 The Crystal Structure Of Murine Cmp-5-N-Acetylneura 1e-09
3fww_A 456 The Crystal Structure Of The Bifunctional N-Acetylg 1e-04
2v0h_A 456 Characterization Of Substrate Binding And Catalysis 0.002
>gi|266618804|pdb|3K8D|A Chain A, Crystal Structure Of E. Coli Lipopolysaccharide Specific Cmp-Kdo Synthetase In Complex With Ctp And 2-Deoxy-Kdo Length = 264 Back     alignment and structure
 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 90/249 (36%), Positives = 120/249 (48%), Gaps = 8/249 (3%)

Query: 8   EKVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQ 67
              +VIIPAR  S R P K L DING PMI+H   RAR++   R+IVA D   +   V  
Sbjct: 17  MSFVVIIPARYASTRLPGKPLVDINGKPMIVHVLERARESGAERIIVATDHEDVARAVEA 76

Query: 68  AGFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNP 127
           AG E  MT   HQSG++R+ E +    +     +IVN+Q D P I   I+  V   L   
Sbjct: 77  AGGEVCMTRADHQSGTERLAEVVEK-CAFSDDTVIVNVQGDEPMIPATIIRQVADNLAQR 135

Query: 128 IVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCF------RALYFTRTKTPHGTGPFY 181
            V + TL   IH + +  +PN VK+V+ +      F                      F 
Sbjct: 136 QVGMATLAVPIHNAEEAFNPNAVKVVLDAEGYALYFSRATIPWDRDRFAEGLETVGDNFL 195

Query: 182 QHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIV-QSNAMSVDTTND 240
           +HLGIY YR   ++R+    PS LE  E LEQLR L    +I V +  +     VDT  D
Sbjct: 196 RHLGIYGYRAGFIRRYVNWQPSPLEHIEMLEQLRVLWYGEKIHVAVAQEVPGTGVDTPED 255

Query: 241 LEKVRTLIP 249
           LE+VR  + 
Sbjct: 256 LERVRAEMR 264


gi|307568402|pdb|3OAM|A Chain A, Crystal Structure Of Cytidylyltransferase From Vibrio Cholerae Length = 252 Back     alignment and structure
>gi|40890001|pdb|1VIC|A Chain A, Crystal Structure Of Cmp-Kdo Synthetase Length = 262 Back     alignment and structure
>gi|40889890|pdb|1VH1|A Chain A, Crystal Structure Of Cmp-Kdo Synthetase Length = 256 Back     alignment and structure
>gi|217035411|pdb|3DUV|A Chain A, Crystal Structure Of 3-Deoxy-Manno-Octulosonate Cytidylyltransferase From Haemophilus Influenzae Complexed With The Substrate 3-Deoxy-Manno-Octulosonate In The- Configuration Length = 262 Back     alignment and structure
>gi|40889895|pdb|1VH3|A Chain A, Crystal Structure Of Cmp-Kdo Synthetase Length = 262 Back     alignment and structure
>gi|15826304|pdb|1H6J|A Chain A, The Three-Dimensional Structure Of Capsule-Specific Cmp:2-Keto-3-Deoxy-Manno-Octonic Acid Synthetase From Escherichia Coli Length = 245 Back     alignment and structure
>gi|313754588|pdb|3POL|A Chain A, 2.3 Angstrom Crystal Structure Of 3-Deoxy-Manno-Octulosonate Cytidylyltransferase (Kdsb) From Acinetobacter Baumannii Length = 276 Back     alignment and structure
>gi|259090408|pdb|3JTJ|A Chain A, 3-Deoxy-Manno-Octulosonate Cytidylyltransferase From Yersinia Pestis Length = 253 Back     alignment and structure
>gi|13399904|pdb|1EYR|A Chain A, Structure Of A Sialic Acid Activating Synthetase, Cmp Acylneuraminate Synthetase In The Presence And Absence Of Cdp Length = 228 Back     alignment and structure
>gi|40889461|pdb|1QWJ|A Chain A, The Crystal Structure Of Murine Cmp-5-N-Acetylneuraminic Acid Synthetase Length = 229 Back     alignment and structure
gi|225734164|pdb|3FWW|A Chain A, The Crystal Structure Of The Bifunctional N-Acetylglucosamine-1- Phosphate UridyltransferaseGLUCOSAMINE-1-Phosphate Acetyltransferase From Yersinia Pestis Co92 Length = 456 Back     alignment and structure
gi|165761161|pdb|2V0H|A Chain A, Characterization Of Substrate Binding And Catalysis Of The Potential Antibacterial Target N-Acetylglucosamine-1- Phosphate Uridyltransferase (Glmu) Length = 456 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target268 3-deoxy-manno-octulosonate cytidylyltransferase [Candid
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; center 4e-42
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; nucleo 2e-39
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; struct 6e-35
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB s 2e-34
2dpw_A232 Hypothetical protein TTHA0179; transferase, structural 4e-26
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, alph 9e-19
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synthetase 2e-15
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; cytid 7e-05
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthase; str 0.002
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, 5e-07
3okr_A231 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TB s 1e-06
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1.60A 2e-05
2wee_A197 MOBA-related protein; unknown function; 1.65A {Mycobact 1e-04
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytidylylt 2e-04
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis protein 5e-04
1w77_A228 2C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.003
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} Length = 252 Back     alignment and structure
 Score =  166 bits (421), Expect = 4e-42
 Identities = 88/252 (34%), Positives = 123/252 (48%), Gaps = 18/252 (7%)

Query: 9   KVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQA 68
              V+IPAR  S R P K LADI G PMI     +A +A   RVI+A DD ++ + V   
Sbjct: 2   SFTVVIPARYQSTRLPGKPLADIGGKPMIQWVYEQAMQAGADRVIIATDDERVEQAVQAF 61

Query: 69  GFESVMTHTSHQSGSDRIFEALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPI 128
           G    MT  +HQSG++R+ E +  +       I+VN+Q D P I P I+  V   L    
Sbjct: 62  GGVVCMTSPNHQSGTERLAEVVAKMAIPAD-HIVVNVQGDEPLIPPAIIRQVADNLAACS 120

Query: 129 VDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYFTRTKTPHG-----------T 177
             + TL   I    +  +PN VK++      +    ALYF+R   P              
Sbjct: 121 APMATLAVEIEDEAEVFNPNAVKVIT-----DKSGYALYFSRATIPWDRDNFAKADKAIV 175

Query: 178 GPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKI-VQSNAMSVD 236
            P  +H+GIYAYR   +  +    PS LE+ E LEQLR L    +I V + +++    VD
Sbjct: 176 QPLLRHIGIYAYRAGFINTYLDWQPSQLEKIECLEQLRVLWHGEKIHVAVALEAPPAGVD 235

Query: 237 TTNDLEKVRTLI 248
           T  DLE VR ++
Sbjct: 236 TPEDLEVVRRIV 247


>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Length = 245 Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Length = 262 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, cytoplasm, lipopolysaccharide biosynthesis, magnesium; HET: KDO CTP; 1.90A {Escherichia coli} PDB: 3k8e_C 1vh1_A 3jtj_A* Length = 264 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.90A {Thermus thermophilus HB8} SCOP: c.68.1.19 Length = 232 Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Length = 228 Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Length = 229 Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP), isoprenoid biosynthesys; HET: CTP; 1.50A {Escherichia coli K12} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 1h3m_A Length = 236 Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthase; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Length = 231 Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Length = 197 Back     alignment and structure
>3okr_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TB structural genomics consortium, TBSGC, tryptophan synthes 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase; 2.40A {Mycobacterium tuberculosis} Length = 231 Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Length = 199 Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A Length = 197 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Length = 246 Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Length = 201 Back     alignment and structure
>1w77_A 2C-methyl-D-erythritol 4-phosphate cytidylyltransferase; plantherbicide, non-mevalonate pathway, isoprenoid; HET: C5P; 2.00A {Arabidopsis thaliana} SCOP: c.68.1.13 Length = 228 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target268 3-deoxy-manno-octulosonate cytidylyltransferase [Candid
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB s 100.0
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; nucleo 100.0
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; struct 100.0
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; center 100.0
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, alph 100.0
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synthetase 100.0
2dpw_A232 Hypothetical protein TTHA0179; transferase, structural 99.95
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytidylylt 99.93
1w77_A228 2C-methyl-D-erythritol 4-phosphate cytidylyltransferase 99.93
3okr_A231 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TB s 99.93
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthase; str 99.92
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; cytid 99.91
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 99.9
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferas 99.87
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1.60A 99.82
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferas 99.8
2wee_A197 MOBA-related protein; unknown function; 1.65A {Mycobact 99.77
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransferase; 3 99.71
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HET: UP 99.68
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein nucl 99.68
3hl3_A269 Glucose-1-phosphate thymidylyltransferase; IDP01254, su 99.68
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleotidyltr 99.65
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnose, nu 99.64
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP-gluco 99.64
3dk5_A 495 Bifunctional protein GLMU; acetyltransferase, pyrophosp 99.62
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyr 99.61
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose-1-ph 99.61
1w55_A 371 ISPD/ISPF bifunctional enzyme; biosynthetic pathway, is 99.55
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosphoryl 99.52
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe 99.5
1yp2_A 451 Glucose-1-phosphate adenylyltransferase small subunit; 99.5
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 99.43
1hv9_A 456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 99.43
3brk_X 420 Glucose-1-phosphate adenylyltransferase; ADP-glucose py 99.4
2ggo_A 401 401AA long hypothetical glucose-1-phosphate thymidylylt 99.29
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; mann 98.72
2x65_A336 Mannose-1-phosphate guanylyltransferase; GDP-mannose bi 98.59
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structural ge 98.36
2i5e_A211 Hypothetical protein MM_2497; APC86122, hypothetic prot 98.13
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT-hand 98.09
3bcv_A240 Putative glycosyltransferase protein; protein structure 97.5
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltransfer 93.61
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; glycos 91.68
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, 99.71
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P (MOBA 99.62
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosynthesi 99.6
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis protein 99.58
3cgx_A242 Putative nucleotide-diphospho-sugar transferase; YP_389 98.37
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type glycosy 93.33
3ckj_A329 Putative uncharacterized protein; mycobacteria, unknown 90.53
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, cytoplasm, lipopolysaccharide biosynthesis, magnesium; HET: KDO CTP; 1.90A {Escherichia coli} PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=381.89  Aligned_cols=235  Identities=41%  Similarity=0.604  Sum_probs=217.4

Q ss_pred             CEEEEEECCCCCCCCCCCEECCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCHHHHCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             56999817767888988500000672266899999996799869998683300010001222222222234565204899
Q gi|254780765|r    9 KVLVIIPARLNSMRFPKKILADINGLPMILHTAIRARKANIGRVIVAVDDTKINEIVLQAGFESVMTHTSHQSGSDRIFE   88 (268)
Q Consensus         9 ki~~iIpAR~~S~Rlp~K~L~~i~gkplI~~v~~~a~~s~~~~viVaTdd~~I~~~~~~~g~~~i~t~~~~~~GTdRi~e   88 (268)
                      |++|+|||||||+|||||+|++|+|+|||+||+++|+++++++|+|+|||++|.+.++++|.++.++++++.+|++|+.+
T Consensus        18 k~i~IIpAR~gSkRlp~KnL~~i~GkPLI~~~i~~ak~s~~~~iiVsTd~~~i~~~~~~~g~~v~~~~~~~~~~~~~~~~   97 (264)
T 3k8d_A           18 SFVVIIPARYASTRLPGKPLVDINGKPMIVHVLERARESGAERIIVATDHEDVARAVEAAGGEVCMTRADHQSGTERLAE   97 (264)
T ss_dssp             CCEEEEECCSCCSSSTTGGGCEETTEEHHHHHHHHHHHTTCSEEEEEESCHHHHHHHHHTTCEEEECCTTCCSHHHHHHH
T ss_pred             CEEEEEECCCCCCCCCCCHHHHCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHCCCCEEEEECCCCCCCCHHHHH
T ss_conf             57999836877987999601440995599999999997699809999676034365420461688742777887379999


Q ss_pred             HHHHHCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCHHHCCCCCCCEEEEECCCCCCCHHHHHC
Q ss_conf             99742233452100001522101000001223332101344321111112201100375443146514544420011110
Q gi|254780765|r   89 ALNIIDSDKKSQIIVNMQADIPNIEPEILASVLLPLQNPIVDIGTLGTRIHGSTDPDDPNIVKIVVASPSENGCFRALYF  168 (268)
Q Consensus        89 a~~~l~~~~~~d~vV~lqGD~Pli~~~~Id~~i~~~~~~~~dv~tl~~~~~~~~~~~d~n~vKvi~~~~~~~~~~~alyf  168 (268)
                      +++.+.. .+++.|+++|||+||++|++++.+++.+...+.+.++.+++......+.|+|.||++.+.++     ++++|
T Consensus        98 ~~~~~~~-~~~~~ii~l~~d~Pl~~~~~i~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~n~vk~~~~~~~-----~~~~~  171 (264)
T 3k8d_A           98 VVEKCAF-SDDTVIVNVQGDEPMIPATIIRQVADNLAQRQVGMATLAVPIHNAEEAFNPNAVKVVLDAEG-----YALYF  171 (264)
T ss_dssp             HHHHHTC-CTTCEEEEECTTCTTCCHHHHHHHHHHHHTSSCSEEEEEEECCSHHHHTCTTSCEEEECTTS-----BEEEE
T ss_pred             HHHHHCC-CCCCEEEEECCCCCCCCCCHHHHHHHHHCCCCCCCEEEEEEECCHHHCCCCCCCEEEECCCC-----CCCCC
T ss_conf             9876125-76748999678533466303455555303566651344201036776248985189886888-----67235


Q ss_pred             CCCCCCCCC-----------CCCCCCEEEEEEEHHHHHHHHCCCCCCCHHHCCHHHHHHHHCCCEEEEEEECC-CCCCCC
Q ss_conf             357775311-----------12235201355200233333207998211120844798997896266998458-888768
Q gi|254780765|r  169 TRTKTPHGT-----------GPFYQHLGIYAYRREALKRFTQLSPSVLEQRESLEQLRALEARMRIDVKIVQS-NAMSVD  236 (268)
Q Consensus       169 sR~~ip~~~-----------~~~~~hvGIy~f~~~~L~~~~~l~~t~lE~~E~lEqLR~leng~~I~~~~~~~-~~~~ID  236 (268)
                      +|+..|...           ..+|+|+|+|+|++++|.++..+++|++|+.|+|||||+||||++|+++.++. .+++||
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~giy~~~~~~l~~~~~~~~s~~E~~e~le~lR~i~~G~~i~~~~~~~~~~~~ID  251 (264)
T 3k8d_A          172 SRATIPWDRDRFAEGLETVGDNFLRHLGIYGYRAGFIRRYVNWQPSPLEHIEMLEQLRVLWYGEKIHVAVAQEVPGTGVD  251 (264)
T ss_dssp             ESSCCSCCHHHHHHCSSCCCSCCEEECSEEEEEHHHHHHHHHSCCCHHHHHHTCTTHHHHHTTCCEEEEECSCCCSCCCC
T ss_pred             CCCCCCHHHHHHHHHHHCCCHHHHEECCEEEEEHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
T ss_conf             43457212233244442044244143225887679988753179985777761899999987993689993799998998


Q ss_pred             CHHHHHHHHHHHH
Q ss_conf             9999999999973
Q gi|254780765|r  237 TTNDLEKVRTLIP  249 (268)
Q Consensus       237 t~~Dl~~v~~il~  249 (268)
                      ||+||+.||++|+
T Consensus       252 t~~Dl~~ae~~lK  264 (264)
T 3k8d_A          252 TPEDLERVRAEMR  264 (264)
T ss_dssp             SHHHHHHHHHHC-
T ss_pred             CHHHHHHHHHHHC
T ss_conf             9999999999609



>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.90A {Thermus thermophilus HB8} SCOP: c.68.1.19 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Back     alignment and structure
>1w77_A 2C-methyl-D-erythritol 4-phosphate cytidylyltransferase; plantherbicide, non-mevalonate pathway, isoprenoid; HET: C5P; 2.00A {Arabidopsis thaliana} SCOP: c.68.1.13 Back     alignment and structure
>3okr_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TB structural genomics consortium, TBSGC, tryptophan synthes 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthase; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP), isoprenoid biosynthesys; HET: CTP; 1.50A {Escherichia coli K12} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 1h3m_A Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure