peg_472

peg_472

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(499568, 500677)Protein Length:369aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:DNA polymerase III subunits gamma and tau (EC 2.7.7.7)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA-replication;
DNA processing cluster
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKKKKT
ccccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEcHHHccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccccccccccEEEEEEcHHHccHHHHHHHHHHHHcccccEEEEEEEccHHHccHHHHcccEEEEcccccHHHHHHHHHHHHHHccccEcHHHHHHHHHHHcccHHHHHHHHHHHHccccccEcHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHEEHHHHccccccHHHHHHHHHHHccccc
MIGQKPMIKTLTNAFKSGRIAQSYMlsgtrgigktTTARIIARSLNyktahidvptvefegfgeHCQAIIRGNHVDvveldaashtsidDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKtleeppphvkfifatteirkipitvlsrcqrfdlhriSIGDLIELFTKILQEESIEFDPEAVAMIARasdgsardGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFssqydsgvnpsviLHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISeiegfsrpMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKKKKT
MIGQKPMIKTLTNAFKSGRIAQSymlsgtrgigktTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAAshtsiddvreIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLahavqlpspeeIARYIVEEKKKKT
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKKKKT
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQ*******************
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKKKKT
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEE*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKKKKT
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKKKKT
MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKKKKT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target369
254780217347 DNA polymerase III subunit delta' [Candidatus Libe 5e-09
254780877853 ATP-dependent Clp protease, ATP-binding subunit pr 0.033
>gi|254780217|ref|YP_003064630.1| DNA polymerase III subunit delta' [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Back     alignment
 Score = 53.5 bits (127), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 109/244 (44%), Gaps = 31/244 (12%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTT----ARIIARSLNYKTAHIDVPT 56
           + G + + K L+  + SGR+  + +  G +GIGK T     A  + ++ ++  A + +  
Sbjct: 14  LFGHEDIEKFLSQYYCSGRMHHALLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCN 73

Query: 57  VEFEGFGEHCQAIIR--GNHV--DVVELDAASHTSIDDVREII--DQI----YYKPISAR 106
                  + C   ++   +H   D + L  + +      R +I  D+I    Y+  ++A 
Sbjct: 74  ------PDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTAN 127

Query: 107 ---FRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLH 163
              +RV ++D V  ++  A N LLK+LEEPP  V FI  +     I  T+ SRC     +
Sbjct: 128 TGYWRVIMIDPVDGMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKFN 187

Query: 164 RISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSS 223
            +S  +L     K L++  I         +  A+ GS    + +L        DKI++S 
Sbjct: 188 SLSENNL----YKALEQLKIMGWDSKRDFVKIAAYGSVARAIKILHYDC----DKIISSY 239

Query: 224 VRLM 227
           + L+
Sbjct: 240 IDLI 243

>gi|254780877|ref|YP_003065290.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter asiaticus str. psy62] Length = 853 Back     alignment
 Score = 30.8 bits (68), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 1   MIGQKPMIKTLTNA---FKSG-----RIAQSYMLSGTRGIGKTTTARIIARSL 45
           +IGQ   +++++NA   F++G     R   S+M  G  G+GKT   + +AR L
Sbjct: 570 VIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLL 622

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target369
315121980363 DNA polymerase III subunits gamma and tau [Candidatus L 1 0.0
222147106 631 DNA polymerase III subunits gamma and tau [Agrobacteriu 1 1e-145
15963983 626 DNA polymerase III subunits gamma and tau [Sinorhizobiu 1 1e-145
307306395 626 DNA polymerase III, subunits gamma and tau [Sinorhizobi 1 1e-145
307319282 626 DNA polymerase III, subunits gamma and tau [Sinorhizobi 1 1e-144
86355786 624 DNA polymerase III subunits gamma and tau [Rhizobium et 1 1e-144
222084336 625 DNA polymerase III [Agrobacterium radiobacter K84] Leng 1 1e-144
116249901 625 DNA polymerase III subunits gamma and tau [Rhizobium le 1 1e-143
209551648 626 DNA polymerase III subunits gamma and tau [Rhizobium le 1 1e-143
227824061 645 DNA polymerase III subunits gamma and tau [Sinorhizobiu 1 1e-143
>gi|315121980|ref|YP_004062469.1| DNA polymerase III subunits gamma and tau [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 363 Back     alignment and organism information
 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/362 (87%), Positives = 344/362 (95%)

Query: 7   MIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHC 66
           M+KTL NAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTA +D+PTVEFEGFGEHC
Sbjct: 1   MVKTLANAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTADVDIPTVEFEGFGEHC 60

Query: 67  QAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGL 126
           Q+II+GNHVDVVELDAASHTSIDDVREII+Q+YYKPISARF+VYIMDEVQMLSTAAFNGL
Sbjct: 61  QSIIQGNHVDVVELDAASHTSIDDVREIIEQMYYKPISARFKVYIMDEVQMLSTAAFNGL 120

Query: 127 LKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFD 186
           LKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDLHRISIG+LI LFTKIL++ESIE D
Sbjct: 121 LKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLHRISIGNLIGLFTKILRQESIESD 180

Query: 187 PEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKG 246
           PE++AMIARASDGS RDGLSLLDQAIARC DKI  S+VRLMLALADRNRIMDLFGYLIKG
Sbjct: 181 PESIAMIARASDGSVRDGLSLLDQAIARCGDKIEASTVRLMLALADRNRIMDLFGYLIKG 240

Query: 247 DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYS 306
           DI+  LQEFS QYDSG NPSV+L+ LA+FTHLVTRIKY+PEMADTLLYSEAEN RA  Y+
Sbjct: 241 DIVKALQEFSLQYDSGANPSVVLYGLADFTHLVTRIKYVPEMADTLLYSEAENLRASGYA 300

Query: 307 KEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKK 366
           KEVS+T LSRFWQMILKG+SEIEGFSRPMEAVEM+LIRLAH+VQLPSPEEIA YIVEEK+
Sbjct: 301 KEVSVTVLSRFWQMILKGLSEIEGFSRPMEAVEMILIRLAHSVQLPSPEEIAHYIVEEKQ 360

Query: 367 KK 368
           KK
Sbjct: 361 KK 362


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147106|ref|YP_002548063.1| DNA polymerase III subunits gamma and tau [Agrobacterium vitis S4] Length = 631 Back     alignment and organism information
>gi|15963983|ref|NP_384336.1| DNA polymerase III subunits gamma and tau [Sinorhizobium meliloti 1021] Length = 626 Back     alignment and organism information
>gi|307306395|ref|ZP_07586139.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti BL225C] Length = 626 Back     alignment and organism information
>gi|307319282|ref|ZP_07598711.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti AK83] Length = 626 Back     alignment and organism information
>gi|86355786|ref|YP_467678.1| DNA polymerase III subunits gamma and tau [Rhizobium etli CFN 42] Length = 624 Back     alignment and organism information
>gi|222084336|ref|YP_002542865.1| DNA polymerase III [Agrobacterium radiobacter K84] Length = 625 Back     alignment and organism information
>gi|116249901|ref|YP_765739.1| DNA polymerase III subunits gamma and tau [Rhizobium leguminosarum bv. viciae 3841] Length = 625 Back     alignment and organism information
>gi|209551648|ref|YP_002283565.1| DNA polymerase III subunits gamma and tau [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 626 Back     alignment and organism information
>gi|227824061|ref|YP_002828034.1| DNA polymerase III subunits gamma and tau [Sinorhizobium fredii NGR234] Length = 645 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target369
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits gamma a 1e-178
TIGR02397355 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamm 1e-112
COG2812 515 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [ 5e-98
>gnl|CDD|181656 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|162839 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>gnl|CDD|32641 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 369
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 100.0
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 100.0
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 100.0
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 100.0
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 100.0
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 100.0
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 100.0
PRK07940395 DNA polymerase III subunit delta'; Validated 100.0
PRK08058329 DNA polymerase III subunit delta'; Validated 100.0
PRK05564313 DNA polymerase III subunit delta'; Validated 100.0
PRK05707328 DNA polymerase III subunit delta'; Validated 100.0
PRK07993334 DNA polymerase III subunit delta'; Validated 100.0
PRK06871324 DNA polymerase III subunit delta'; Validated 100.0
PRK07471363 DNA polymerase III subunit delta'; Validated 100.0
PRK06964342 DNA polymerase III subunit delta'; Validated 100.0
PRK09112352 DNA polymerase III subunit delta'; Validated 100.0
PRK08699325 DNA polymerase III subunit delta'; Validated 100.0
PRK12402337 replication factor C small subunit 2; Reviewed 100.0
PRK07399314 DNA polymerase III subunit delta'; Validated 100.0
PRK07276290 DNA polymerase III subunit delta'; Validated 100.0
PRK06090319 DNA polymerase III subunit delta'; Validated 100.0
PRK08769319 DNA polymerase III subunit delta'; Validated 100.0
PRK00440318 rfc replication factor C small subunit; Reviewed 100.0
PRK05917290 DNA polymerase III subunit delta'; Validated 100.0
KOG0989346 consensus 100.0
PRK07132303 DNA polymerase III subunit delta'; Validated 100.0
KOG0991333 consensus 100.0
KOG2035351 consensus 99.94
KOG2028554 consensus 99.93
PRK05574336 holA DNA polymerase III subunit delta; Reviewed 99.93
PRK07452326 DNA polymerase III subunit delta; Validated 99.93
PRK05629331 hypothetical protein; Validated 99.92
PRK07914320 hypothetical protein; Reviewed 99.85
PRK06585343 holA DNA polymerase III subunit delta; Reviewed 99.84
PRK08487328 DNA polymerase III subunit delta; Validated 99.8
COG1466334 HolA DNA polymerase III, delta subunit [DNA replication 99.77
) and delta prime (holB) subunits are distinct proteins encoded by separate genes. The delta prime subunit (holB) exhibits sequence homology to the tau and gamma subunits (dnaX), but the delta subunit (holA) does not demonstrate this same homology with dnaX. The delta, delta prime, gamma, chi and psi subunits form the gamma complex sub-assembly of DNA polymerase III holoenzyme, which couples ATP to assemble the ring-shaped beta subunit around DNA forming a DNA sliding clamp. Both delta and delta prime are monomeric in their native state, and they bind each other tightly to form a 1:1 complex. Neither delta nor delta prime alone binds tightly to the gamma subunit . ; GO: 0003677 DNA binding, 0003891 delta DNA polymerase activity, 0006260 DNA replication, 0043625 delta DNA polymerase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01128">TIGR01128331 holA DNA polymerase III, delta subunit; InterPro: IPR00 99.39
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 97.85
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 100.0
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 100.0
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 100.0
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.78
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.77
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.76
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 99.69
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 99.57
CHL00181287 cbbX CbbX; Provisional 99.56
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.53
KOG1969 877 consensus 99.53
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 99.51
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 99.34
PRK10865 857 protein disaggregation chaperone; Provisional 99.29
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.29
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.28
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.28
CHL00095 823 clpC Clp protease ATP binding subunit 99.26
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.22
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.2
KOG1970 634 consensus 99.2
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 99.17
PRK03992390 proteasome-activating nucleotidase; Provisional 99.11
CHL00176631 ftsH cell division protein; Validated 99.09
KOG1968 871 consensus 99.08
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 99.06
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.05
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.97
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.95
PRK08903227 hypothetical protein; Validated 98.94
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.91
KOG2004 906 consensus 98.88
PRK13765 637 ATP-dependent protease Lon; Provisional 98.87
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.82
CHL00195491 ycf46 Ycf46; Provisional 98.81
PRK08084235 DNA replication initiation factor; Provisional 98.8
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.8
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.8
PRK08727233 hypothetical protein; Validated 98.75
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 98.74
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.73
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.72
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 98.71
pfam06144172 DNA_pol3_delta DNA polymerase III, delta subunit. DNA p 98.69
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 98.66
PRK06620214 hypothetical protein; Validated 98.62
KOG0733 802 consensus 98.55
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 98.54
COG1221403 PspF Transcriptional regulators containing an AAA-type 98.51
KOG0738491 consensus 98.5
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 98.49
PRK11608325 pspF phage shock protein operon transcriptional activat 98.48
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.47
PRK09087226 hypothetical protein; Validated 98.45
KOG2227529 consensus 98.38
KOG0734752 consensus 98.35
KOG1514767 consensus 98.34
KOG0740428 consensus 98.3
PRK10365441 transcriptional regulatory protein ZraR; Provisional 98.29
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 98.27
PRK12422455 chromosomal replication initiation protein; Provisional 98.25
PRK05022510 anaerobic nitric oxide reductase transcription regulato 98.25
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.22
KOG0736 953 consensus 98.17
PRK04841 903 transcriptional regulator MalT; Provisional 98.15
KOG0733802 consensus 98.14
KOG0737386 consensus 98.04
COG2204464 AtoC Response regulator containing CheY-like receiver, 98.01
pfam05621302 TniB Bacterial TniB protein. This family consists of se 98.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 97.95
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 97.93
KOG0735 952 consensus 97.86
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 97.83
pfam00931285 NB-ARC NB-ARC domain. 97.83
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 97.8
KOG0730693 consensus 97.55
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 97.51
KOG0652424 consensus 97.46
KOG0735952 consensus 97.29
KOG1051 898 consensus 96.66
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 96.45
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 96.2
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 96.16
KOG4658 889 consensus 95.9
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 95.56
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 95.19
PRK05818262 DNA polymerase III subunit delta'; Validated 100.0
PRK13342417 recombination factor protein RarA; Reviewed 100.0
PRK04195403 replication factor C large subunit; Provisional 100.0
PRK13341 726 recombination factor protein RarA/unknown domain fusion 100.0
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 100.0
KOG0990360 consensus 99.97
PTZ00112650 origin recognition complex 1 protein; Provisional 98.95
PRK06581263 DNA polymerase III subunit delta'; Validated 99.96
PRK04132 863 replication factor C small subunit; Provisional 99.74
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.35
pfam00004131 AAA ATPase family associated with various cellular acti 99.24
PRK10865857 protein disaggregation chaperone; Provisional 98.96
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.95
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 98.87
KOG1051898 consensus 98.86
COG0714329 MoxR-like ATPases [General function prediction only] 98.8
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.76
CHL00095823 clpC Clp protease ATP binding subunit 98.74
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.71
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.66
KOG0742630 consensus 98.58
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.56
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 98.46
KOG0743457 consensus 98.45
smart00382148 AAA ATPases associated with a variety of cellular activ 98.42
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 98.37
KOG0731774 consensus 98.34
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 98.29
KOG2170344 consensus 98.19
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational modi 98.17
KOG0744423 consensus 98.15
pfam00493327 MCM MCM2/3/5 family. 98.09
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 97.99
PRK09862506 putative ATP-dependent protease; Provisional 97.93
PRK10875607 recD exonuclease V subunit alpha; Provisional 97.9
KOG0741 744 consensus 97.9
TIGR02030340 BchI-ChlI magnesium chelatase ATPase subunit I; InterPr 97.67
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.62
PRK12377248 putative replication protein; Provisional 97.58
PRK09183258 transposase/IS protein; Provisional 97.57
KOG1808 1856 consensus 97.57
PRK06526254 transposase; Provisional 97.53
PRK08116262 hypothetical protein; Validated 97.53
smart00350509 MCM minichromosome maintenance proteins. 97.52
PRK11545177 gntK gluconate kinase 1; Provisional 97.47
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.42
PRK08181269 transposase; Validated 97.41
KOG0736953 consensus 97.33
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.32
KOG0727408 consensus 97.28
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 97.24
KOG0741744 consensus 97.23
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 97.22
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.18
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 97.17
PRK13695174 putative NTPase; Provisional 97.17
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.14
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.14
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.08
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 97.07
KOG0732 1080 consensus 97.06
PRK09825176 idnK D-gluconate kinase; Provisional 97.05
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.0
KOG0651388 consensus 96.92
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.77
PRK13531 498 regulatory ATPase RavA; Provisional 96.77
KOG0922 674 consensus 96.72
KOG0729435 consensus 96.72
KOG0728404 consensus 96.65
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 96.61
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.6
PRK04220306 2-phosphoglycerate kinase; Provisional 96.57
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 96.56
pfam04851103 ResIII Type III restriction enzyme, res subunit. 96.55
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 96.36
KOG0478804 consensus 96.24
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 96.22
KOG0726440 consensus 96.17
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 96.16
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.07
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 96.06
KOG2543438 consensus 95.91
KOG18051100 consensus 95.9
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.87
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.86
PHA00350402 putative assembly protein 95.85
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 95.74
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 95.59
PRK10867453 signal recognition particle protein; Provisional 95.58
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 95.56
KOG0477854 consensus 95.55
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 95.51
PRK10416499 cell division protein FtsY; Provisional 95.49
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.47
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.38
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 95.37
pfam01745232 IPT Isopentenyl transferase. Isopentenyl transferase / 95.36
PRK00771433 signal recognition particle protein Srp54; Provisional 95.36
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 95.32
pfam05272198 VirE Virulence-associated protein E. This family contai 95.21
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 95.18
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 95.07
COG1485367 Predicted ATPase [General function prediction only] 95.01
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 94.96
PRK10536262 hypothetical protein; Provisional 94.88
KOG2228408 consensus 94.8
COG1674858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 94.78
COG1241682 MCM2 Predicted ATPase involved in replication control, 94.76
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 94.74
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 94.32
pfam02572172 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 94.3
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 94.23
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 94.19
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 94.14
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 94.03
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 93.98
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 93.9
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 93.88
PRK13766 764 Hef nuclease; Provisional 93.56
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 93.47
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 93.12
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 93.04
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 93.02
PRK12338320 hypothetical protein; Provisional 92.9
KOG3354191 consensus 92.88
KOG0354 746 consensus 92.86
COG5635 824 Predicted NTPase (NACHT family) [Signal transduction me 92.63
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 92.54
PRK04132863 replication factor C small subunit; Provisional 99.96
PRK05907311 hypothetical protein; Provisional 98.83
pfam12169143 DNA_pol3_gamma3 DNA polymerase III subunits gamma and t 99.84
pfam0854290 Rep_fac_C Replication factor C. This family includes se 95.63
pfam09115119 DNApol3-delta_C DNA polymerase III, delta subunit, C te 95.17
PRK08485204 DNA polymerase III subunit delta'; Validated 99.61
smart00487201 DEXDc DEAD-like helicases superfamily. 97.17
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 96.99
COG4178604 ABC-type uncharacterized transport system, permease and 96.96
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 96.79
KOG1803649 consensus 96.65
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 96.64
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 96.44
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.78
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanisms] 94.21
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 94.12
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 93.95
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 93.92
PRK11147 632 ABC transporter ATPase component; Reviewed 93.56
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 93.46
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 93.23
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 93.17
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 99.48
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 99.27
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.12
KOG1942456 consensus 99.01
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 98.93
KOG2680454 consensus 98.71
PRK13898800 type IV secretion system ATPase VirB4; Provisional 97.17
PRK13873815 conjugal transfer ATPase TrbE; Provisional 97.14
pfam05872504 DUF853 Bacterial protein of unknown function (DUF853). 94.35
TIGR00929931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 92.9
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 99.17
PRK05642234 DNA replication initiation factor; Validated 98.96
PRK06893229 DNA replication initiation factor; Validated 98.91
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 94.46
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 99.11
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 98.87
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 98.44
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 98.42
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 98.41
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 98.38
pfam07726131 AAA_3 ATPase family associated with various cellular ac 98.35
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 98.04
KOG0745564 consensus 97.76
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 97.68
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 97.63
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.17
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.04
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 96.82
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.12
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 95.6
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 95.59
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 94.89
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 94.77
COG4650531 RtcR Sigma54-dependent transcription regulator containi 94.71
KOG0925 699 consensus 94.49
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 94.44
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 94.38
KOG0923 902 consensus 94.1
PRK13833323 conjugal transfer protein TrbB; Provisional 93.72
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 93.58
COG2842297 Uncharacterized ATPase, putative transposase [General f 93.39
PRK10646153 putative ATPase; Provisional 92.97
KOG0924 1042 consensus 92.95
KOG0730 693 consensus 98.88
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 97.98
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 97.85
PRK13853789 type IV secretion system protein VirB4; Provisional 97.59
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 97.5
PRK06835330 DNA replication protein DnaC; Validated 96.97
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 96.95
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.93
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.87
PRK03839180 putative kinase; Provisional 96.75
pfam06309127 Torsin Torsin. This family consists of several eukaryot 96.63
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 96.62
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 96.61
PRK07952242 DNA replication protein DnaC; Validated 96.59
PRK06067241 flagellar accessory protein FlaH; Validated 96.53
PRK13948182 shikimate kinase; Provisional 96.52
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 96.48
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 96.47
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.4
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.4
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 96.39
PRK00131175 aroK shikimate kinase; Reviewed 96.35
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 96.35
PRK13947171 shikimate kinase; Provisional 96.34
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 96.3
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 96.3
COG1119257 ModF ABC-type molybdenum transport system, ATPase compo 96.27
PRK05057172 aroK shikimate kinase I; Reviewed 96.26
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.26
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 96.21
PRK13946195 shikimate kinase; Provisional 96.15
PRK13949169 shikimate kinase; Provisional 96.12
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 96.09
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.04
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 96.01
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.01
PRK13851343 type IV secretion system protein VirB11; Provisional 96.0
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 95.99
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 95.97
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.96
PRK09435325 arginine/ornithine transport system ATPase; Provisional 95.96
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.91
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 95.9
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 95.9
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.87
PRK11823454 DNA repair protein RadA; Provisional 95.79
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 95.79
PRK09302 501 circadian clock protein KaiC; Reviewed 95.7
PRK13544208 consensus 95.65
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 95.65
PRK13891852 conjugal transfer protein TrbE; Provisional 95.64
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 95.63
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 95.6
PRK03846198 adenylylsulfate kinase; Provisional 95.58
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.53
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.53
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.52
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 95.5
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 95.49
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.47
PRK00300208 gmk guanylate kinase; Provisional 95.47
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.39
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 95.32
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 95.29
cd03114148 ArgK-like The function of this protein family is unkown 95.25
PRK06921265 hypothetical protein; Provisional 95.2
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 95.14
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.09
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.04
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.02
PRK13764605 ATPase; Provisional 94.98
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 94.98
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 94.97
PRK03731172 aroL shikimate kinase II; Reviewed 94.95
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 94.94
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 94.88
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 94.87
PRK09270230 frcK putative fructose transport system kinase; Reviewe 94.81
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 94.77
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 94.77
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 94.72
PRK02496185 adk adenylate kinase; Provisional 94.7
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.66
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 94.66
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 94.6
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 94.57
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.57
PRK13768253 GTPase; Provisional 94.57
PRK08118167 topology modulation protein; Reviewed 94.55
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 94.5
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 94.45
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 94.4
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 94.39
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 94.39
PRK00279215 adk adenylate kinase; Reviewed 94.35
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 94.34
PRK04328250 hypothetical protein; Provisional 94.3
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 94.28
PRK13542224 consensus 94.26
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 94.25
PTZ00088225 adenylate kinase 1; Provisional 94.25
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 94.25
PRK07261171 topology modulation protein; Provisional 94.24
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.22
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 94.2
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 94.18
PRK00625173 shikimate kinase; Provisional 94.14
PRK09302501 circadian clock protein KaiC; Reviewed 94.14
PRK06696227 uridine kinase; Validated 94.13
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 94.09
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.08
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 94.08
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 94.05
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 94.05
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 93.97
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 93.97
KOG3347176 consensus 93.96
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 93.92
cd01124187 KaiC KaiC is a circadian clock protein primarily found 93.86
PRK00023225 cmk cytidylate kinase; Provisional 93.83
PRK05541176 adenylylsulfate kinase; Provisional 93.75
PRK13894320 conjugal transfer ATPase TrbB; Provisional 93.74
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 93.74
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 93.71
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 93.64
PRK07263453 consensus 93.63
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 93.62
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 93.59
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 93.57
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 93.51
TIGR00954788 3a01203 Peroxysomal long chain fatty acyl transporter; 93.46
KOG0952 1230 consensus 93.42
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 93.4
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 93.38
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 93.33
COG1855604 ATPase (PilT family) [General function prediction only] 93.33
pfam00625182 Guanylate_kin Guanylate kinase. 93.32
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 93.29
PRK05595444 replicative DNA helicase; Provisional 93.23
pfam00406186 ADK Adenylate kinase. 93.16
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 93.12
PRK04301318 radA DNA repair and recombination protein RadA; Validat 93.08
COG4619223 ABC-type uncharacterized transport system, ATPase compo 93.06
PHA02244383 ATPase-like protein 92.98
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 92.96
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 92.89
PRK12337492 2-phosphoglycerate kinase; Provisional 92.89
PRK00889175 adenylylsulfate kinase; Provisional 92.83
PRK08506473 replicative DNA helicase; Provisional 92.81
PRK05748448 replicative DNA helicase; Provisional 92.73
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 92.69
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 92.68
PRK08840464 replicative DNA helicase; Provisional 92.56
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 92.54
KOG0739439 consensus 97.98
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.14
PRK13830818 conjugal transfer protein TrbE; Provisional 96.68
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 94.31
COG0802149 Predicted ATPase or kinase [General function prediction 93.03
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 96.41
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.31
PRK10790593 putative multidrug transporter membrane\ATP-binding com 96.3
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.23
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.06
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.81
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 95.72
PRK08939306 primosomal protein DnaI; Reviewed 94.3
KOG1533290 consensus 94.82
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08770 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08853 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07270 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0989 consensus Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0991 consensus Back     alignment and domain information
>KOG2035 consensus Back     alignment and domain information
>KOG2028 consensus Back     alignment and domain information
>PRK05574 holA DNA polymerase III subunit delta; Reviewed Back     alignment and domain information
>PRK07452 DNA polymerase III subunit delta; Validated Back     alignment and domain information
>PRK05629 hypothetical protein; Validated Back     alignment and domain information
>PRK07914 hypothetical protein; Reviewed Back     alignment and domain information
>PRK06585 holA DNA polymerase III subunit delta; Reviewed Back     alignment and domain information