254780766

254780766

recombination protein F

GeneID in NCBI database:8209772Locus tag:CLIBASIA_03285
Protein GI in NCBI database:254780766Protein Accession:YP_003065179.1
Gene range:+(496231, 497358)Protein Length:375aa
Gene description:recombination protein F
COG prediction:[L] Recombinational DNA repair ATPase (RecF pathway)
KEGG prediction:recF; recombination protein F; K03629 DNA replication and repair protein RecF
SEED prediction:DNA recombination and repair protein RecF
Pathway involved in KEGG:Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA repair, bacterial RecFOR pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
cccccEEEEEEEEcccccccEEEEccccEEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHccccccEEEEEEEEccccccEEEEEEEEcccccEEEEEEcccHHHHHHHHHHHccEEEEcccHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHcccHHHHHHHHHHHHccccEEEEEEccHHHHHHcccccEEEEEEccEEEEc
ccccEEEEEEEEEccccccHccccccccEEEEEcccccccccHHHHHHHHHHHccccccccccEEEcccccEEEEEEEEEcccccEccccccEEEcccccEEEEEccccHHHHHHHHccccEEEEcccccHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHcHHHHHHHHHHHHHcccEEEEEEccHHHHHHccccccEEEEEccEEEEc
MTNRIKIKFLNISEFRNYASLRLVFDAQHTifvgdngvgkTNILEAISflspgrgfrrasyadvtrigspsffsTFARVEGMEGLADISIKLetrddrsvrclQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVfaidprhrrrmidFERLMRGRNRLltegyfdsswcSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKenfphiklsltgfldgkfdQSFCALKEEYAKKLFdgrkmdsmsrrtligphrsdliVDYCDKAitiahgstgeQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIgsqifmtgtdkSVFDSLNETAKFMRISNHQALCI
mtnrikikflnisEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAIsflspgrgfRRASYADVTRIGSPSFFSTFARVEGMEGLADISIkletrddrsvrclqindvvirVVDELNKHlriswlvpsmdrIFSGLSMERRRFLdrmvfaidprhrrrmidferlmrGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAkklfdgrkmdsmsrrtligphrsdLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
**NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADI****************INDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
**NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI
MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALCI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target375 recombination protein F [Candidatus Liberibacter asiati
254780640110 hypothetical protein CLIBASIA_02635 [Candidatus Li 0.003
255764514 554 DNA repair protein RecN [Candidatus Liberibacter a 0.027
>gi|254780640|ref|YP_003065053.1| hypothetical protein CLIBASIA_02635 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Back     alignment
 Score = 34.3 bits (77), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 6  KIKFLNISEFRNYASLRLVFDAQH-TIFVGDNGVGKTNILEAISFLSPGRGFRR 58
          K+  + IS FR +  ++ +  A H TI  G NG GK+++ EAI +L  G   RR
Sbjct: 28 KLLDIEISHFRGFTEIQKIEFADHLTIVNGQNGYGKSSLSEAIEWLFYGYTQRR 81

>gi|255764514|ref|YP_003065586.2| DNA repair protein RecN [Candidatus Liberibacter asiaticus str. psy62] Length = 554 Back     alignment
 Score = 31.2 bits (69), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 20 SLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG 55
          SL + F A  +I  GD G GK+ +L+A+  ++ GRG
Sbjct: 14 SLDIDFSAGLSILSGDTGSGKSILLDALILVTGGRG 49

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target375 recombination protein F [Candidatus Liberibacter asiati
315121983375 recombination protein F [Candidatus Liberibacter solana 1 1e-180
222084353375 DNA replication and repair protein [Agrobacterium radio 1 1e-110
116249915374 recombination protein F [Rhizobium leguminosarum bv. vi 1 1e-110
241207093374 recombination protein F [Rhizobium leguminosarum bv. tr 1 1e-110
190889810374 DNA replication and repair protein [Rhizobium etli CIAT 1 1e-109
209551663374 recombination protein F [Rhizobium leguminosarum bv. tr 1 1e-108
86355801374 recombination protein F [Rhizobium etli CFN 42] Length 1 1e-108
218515494367 recombination protein F [Rhizobium etli 8C-3] Length = 1 1e-108
327192780442 DNA replication and repair protein [Rhizobium etli CNPA 1 1e-108
48527207374 RecF [Rhizobium etli] Length = 374 1 1e-107
>gi|315121983|ref|YP_004062472.1| recombination protein F [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 375 Back     alignment and organism information
 Score =  634 bits (1634), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/373 (81%), Positives = 342/373 (91%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M N+IKIK LN+SEFRNY SLRLVFD+Q TIFVGDNG GKTNILEAIS LSPGRG RRAS
Sbjct: 1   MINKIKIKRLNVSEFRNYVSLRLVFDSQQTIFVGDNGAGKTNILEAISLLSPGRGLRRAS 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y+DVTRIGS S FSTFA VEGM+GLA+ISIKLE++DDRS+RCL+INDV IRVVDELN HL
Sbjct: 61  YSDVTRIGSLSLFSTFACVEGMDGLAEISIKLESKDDRSIRCLRINDVAIRVVDELNSHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+SWLVPSMDRIFSG S ERRRFLDRMVF+IDPRHRRR+IDFERLMRGRNRLL+EG FD 
Sbjct: 121 RVSWLVPSMDRIFSGPSTERRRFLDRMVFSIDPRHRRRIIDFERLMRGRNRLLSEGCFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SWCSSIE+QMA LGV+I+IARV+MI+ LSSL+ EY+QKENFPH++L+LTGFLDGK +QSF
Sbjct: 181 SWCSSIESQMAGLGVEIDIARVKMIDELSSLMAEYIQKENFPHVELNLTGFLDGKLNQSF 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             LK+EY K LFDGR++DS++RRTLIGPHRSDL+VDYCDK I I HGSTGEQKVVLVGIF
Sbjct: 241 LELKQEYVKILFDGRRIDSIARRTLIGPHRSDLVVDYCDKDIKIVHGSTGEQKVVLVGIF 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARLISNTTGFAPILLLDEISAHLDE +RNALFRIV+DIGSQIF+TGTD+S+F SL++
Sbjct: 301 LAHARLISNTTGFAPILLLDEISAHLDEGRRNALFRIVSDIGSQIFITGTDRSMFSSLSD 360

Query: 361 TAKFMRISNHQAL 373
           TA FMRI+NHQA 
Sbjct: 361 TATFMRIANHQAF 373


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084353|ref|YP_002542882.1| DNA replication and repair protein [Agrobacterium radiobacter K84] Length = 375 Back     alignment and organism information
>gi|116249915|ref|YP_765753.1| recombination protein F [Rhizobium leguminosarum bv. viciae 3841] Length = 374 Back     alignment and organism information
>gi|241207093|ref|YP_002978189.1| recombination protein F [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 374 Back     alignment and organism information
>gi|190889810|ref|YP_001976352.1| DNA replication and repair protein [Rhizobium etli CIAT 652] Length = 374 Back     alignment and organism information
>gi|209551663|ref|YP_002283580.1| recombination protein F [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 374 Back     alignment and organism information
>gi|86355801|ref|YP_467693.1| recombination protein F [Rhizobium etli CFN 42] Length = 374 Back     alignment and organism information
>gi|218515494|ref|ZP_03512334.1| recombination protein F [Rhizobium etli 8C-3] Length = 367 Back     alignment and organism information
>gi|327192780|gb|EGE59709.1| DNA replication and repair protein [Rhizobium etli CNPAF512] Length = 442 Back     alignment and organism information
>gi|48527207|gb|AAT45744.1| RecF [Rhizobium etli] Length = 374 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target375 recombination protein F [Candidatus Liberibacter asiati
PRK00064361 PRK00064, recF, recombination protein F; Reviewed 2e-95
TIGR00611365 TIGR00611, recf, recF protein 2e-37
PRK14079349 PRK14079, recF, recombination protein F; Provisional 6e-24
COG1195363 COG1195, RecF, Recombinational DNA repair ATPase (RecF 2e-78
cd03242270 cd03242, ABC_RecF, RecF is a recombinational DNA repair 6e-36
cd03242270 cd03242, ABC_RecF, RecF is a recombinational DNA repair 5e-21
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-06
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein; Pro 3e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 4e-04
COG1106371 COG1106, COG1106, Predicted ATPases [General function p 5e-04
cd03278197 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell divi 0.004
>gnl|CDD|178835 PRK00064, recF, recombination protein F; Reviewed Back     alignment and domain information
>gnl|CDD|161957 TIGR00611, recf, recF protein Back     alignment and domain information
>gnl|CDD|184491 PRK14079, recF, recombination protein F; Provisional Back     alignment and domain information
>gnl|CDD|31388 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|73001 cd03242, ABC_RecF, RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>gnl|CDD|73001 cd03242, ABC_RecF, RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>gnl|CDD|145545 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|179675 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31303 COG1106, COG1106, Predicted ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|73037 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>gnl|CDD|31389 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 375 recombination protein F [Candidatus Liberibacter asiati
PRK00064355 recF recombination protein F; Reviewed 100.0
COG1195363 RecF Recombinational DNA repair ATPase (RecF pathway) [ 100.0
TIGR00611399 recf DNA replication and repair protein RecF; InterPro: 100.0
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPase th 100.0
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are 99.92
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are 99.91
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are 99.9
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are 99.87
TIGR00634605 recN DNA repair protein RecN; InterPro: IPR004604 DNA r 99.82
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-b 99.79
TIGR02169 1202 SMC_prok_A chromosome segregation protein SMC; InterPro 99.94
TIGR02168 1191 SMC_prok_B chromosome segregation protein SMC; InterPro 99.93
PRK10869 553 recombination and repair protein; Provisional 99.92
COG1196 1163 Smc Chromosome segregation ATPases [Cell division and c 99.88
pfam02463 1162 SMC_N RecF/RecN/SMC N terminal domain. This domain is f 99.88
PRK02224 880 chromosome segregation protein; Provisional 99.88
COG0497 557 RecN ATPase involved in DNA repair [DNA replication, re 99.88
PRK01156 895 chromosome segregation protein; Provisional 99.87
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 99.78
KOG0250 1074 consensus 99.69
KOG0018 1141 consensus 99.59
PRK10246 1047 exonuclease subunit SbcC; Provisional 99.52
TIGR00606 1328 rad50 rad50; InterPro: IPR004584 Rad50 is involved in r 99.17
COG3593 581 Predicted ATP-dependent endonuclease of the OLD family 99.88
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are 99.77
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are 99.65
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes ar 99.53
COG4938374 Uncharacterized conserved protein [Function unknown] 99.17
KOG0962 1294 consensus 99.08
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 99.06
COG4717 984 Uncharacterized conserved protein [Function unknown] 98.4
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 98.12
PRK04863 1486 mukB cell division protein MukB; Provisional 97.97
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 97.93
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 97.89
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 97.78
PRK13542224 consensus 97.69
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 97.68
PRK03695245 vitamin B12-transporter ATPase; Provisional 97.68
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.67
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.66
cd03234226 ABCG_White The White subfamily represents ABC transport 97.63
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 97.62
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 97.61
PRK13544208 consensus 97.6
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 97.6
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.6
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 97.58
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.58
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 97.58
pfam04310227 MukB MukB N-terminal. This family represents the N-term 97.58
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 97.57
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 97.55
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 97.54
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 97.52
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 97.52
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.52
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 97.51
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 97.51
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.51
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 97.51
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 97.5
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 97.49
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 97.49
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.48
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 97.47
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 97.47
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 97.47
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 97.47
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 97.46
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 97.46
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.45
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 97.43
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.43
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 97.43
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.42
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 97.42
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 97.41
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 97.4
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.4
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 97.39
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.39
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.39
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 97.39
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 97.39
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.37
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 97.36
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 97.36
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.36
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.34
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 97.34
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 97.34
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 97.33
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 97.32
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 97.32
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.31
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 97.31
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.31
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.3
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 97.29
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 97.28
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 97.27
PRK10744257 phosphate transporter subunit; Provisional 97.26
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 97.26
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.26
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 97.25
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.25
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 97.23
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.23
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 97.23
COG4559259 ABC-type hemin transport system, ATPase component [Inor 97.22
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.22
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 97.22
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 97.22
PRK10908222 cell division protein FtsE; Provisional 97.21
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.2
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.2
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.2
PRK13536306 nodulation factor exporter subunit NodI; Provisional 97.2
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.19
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.19
pfam12128 1192 DUF3584 Protein of unknown function (DUF3584). This pro 97.17
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.16
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.15
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 97.14
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 97.11
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.11
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.11
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.11
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 97.07
COG4133209 CcmA ABC-type transport system involved in cytochrome c 97.07
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.06
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.06
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.05
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.04
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.04
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.02
PTZ00243 1560 ABC transporter; Provisional 96.98
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 96.98
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.96
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 96.96
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 96.93
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 96.91
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.9
COG5293 591 Predicted ATPase [General function prediction only] 96.89
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.88
TIGR01188343 drrA daunorubicin resistance ABC transporter, ATP-bindi 96.88
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 96.86
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.85
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.85
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 96.83
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 96.82
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 96.8
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 96.79
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 96.79
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 96.78
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 96.76
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 96.74
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 96.73
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 96.72
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.72
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.71
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 96.7
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 96.68
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.67
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.62
COG0411250 LivG ABC-type branched-chain amino acid transport syste 96.6
COG0410237 LivF ABC-type branched-chain amino acid transport syste 96.59
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter; InterPro: I 96.57
KOG0054 1381 consensus 96.57
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 96.54
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 96.53
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 96.53
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 96.53
KOG0062 582 consensus 96.48
COG4913 1104 Uncharacterized protein conserved in bacteria [Function 96.46
PRK10522547 multidrug transporter membrane component/ATP-binding co 96.44
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 96.4
COG1119257 ModF ABC-type molybdenum transport system, ATPase compo 96.4
COG4674249 Uncharacterized ABC-type transport system, ATPase compo 96.39
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 96.38
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 96.32
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.31
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 96.27
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA mismat 96.26
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 96.17
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes. Th 96.16
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 96.1
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.08
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.08
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.07
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 96.05
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein 96.03
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 96.02
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.02
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 96.02
COG3950440 Predicted ATP-binding protein involved in virulence [Ge 99.84
PRK03918882 chromosome segregation protein; Provisional 99.84
cd03239178 ABC_SMC_head The structural maintenance of chromosomes 99.8
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. This m 99.77
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 99.73
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 99.67
COG4637373 Predicted ATPase [General function prediction only] 99.67
COG1106371 Predicted ATPases [General function prediction only] 99.57
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 99.51
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 99.49
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 99.47
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 99.46
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 99.45
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 99.45
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 99.43
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 99.42
PRK09984262 phosphonate/organophosphate ester transporter subunit; 99.42
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 99.38
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 99.34
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 99.32
cd03246173 ABCC_Protease_Secretion This family represents the ABC 99.32
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 99.32
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 99.29
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 99.27
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 99.27
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 99.26
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 99.23
pfam024631162 SMC_N RecF/RecN/SMC N terminal domain. This domain is f 99.21
PRK10790593 putative multidrug transporter membrane\ATP-binding com 99.13
COG11961163 Smc Chromosome segregation ATPases [Cell division and c 99.12
PRK02224880 chromosome segregation protein; Provisional 99.0
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 98.99
KOG0927614 consensus 98.9
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 98.87
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.86
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 98.85
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 98.85
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 98.84
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 98.84
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 98.84
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.83
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 98.8
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.8
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.79
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 98.79
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 98.78
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 98.78
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 98.77
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 98.77
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 98.76
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.76
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 98.76
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 98.75
PRK13536306 nodulation factor exporter subunit NodI; Provisional 98.75
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 98.75
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.75
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 98.74
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.74
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 98.74
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 98.73
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 98.73
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 98.73
PRK01156895 chromosome segregation protein; Provisional 98.73
COG4604252 CeuD ABC-type enterochelin transport system, ATPase com 98.72
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.72
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 98.72
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 98.71
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 98.71
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.71
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 98.69
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.69
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 98.69
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 98.69
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.68
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 98.68
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 98.68
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 98.68
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 98.68
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 98.68
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.68
COG0419908 SbcC ATPase involved in DNA repair [DNA replication, re 98.67
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 98.67
cd03234226 ABCG_White The White subfamily represents ABC transport 98.67
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 98.66
PRK10908222 cell division protein FtsE; Provisional 98.66
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 98.66
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.65
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 98.65
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 98.65
PRK13544208 consensus 98.65
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.64
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.62
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 98.62
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 98.62
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 98.62
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 98.61
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 98.61
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 98.61
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.61
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.61
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 98.6
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 98.59
PRK10744257 phosphate transporter subunit; Provisional 98.59
PRK11147 632 ABC transporter ATPase component; Reviewed 98.59
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 98.58
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 98.58
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 98.58
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 98.58
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 98.57
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 98.57
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 98.57
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 98.57
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.56
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 98.56
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 98.55
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 98.55
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 98.55
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 98.54
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 98.54
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.54
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.54
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.54
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 98.53
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 98.53
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 98.53
PRK13549513 xylose transporter ATP-binding subunit; Provisional 98.52
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 98.52
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 98.52
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 98.5
PRK03695245 vitamin B12-transporter ATPase; Provisional 98.5
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 98.5
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 98.49
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 98.49
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.48
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 98.48
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.48
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 98.48
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 98.47
PRK10762501 D-ribose transporter ATP binding protein; Provisional 98.47
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 98.47
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 98.47
PRK11147 632 ABC transporter ATPase component; Reviewed 98.46
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 98.46
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 98.45
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 98.45
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 98.44
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 98.44
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 98.43
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 98.43
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 98.42
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 98.42
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 98.41
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 98.41
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 98.41
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 98.39
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 98.39
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 98.38
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 98.38
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 98.38
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 98.38
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 98.37
PRK09700510 D-allose transporter ATP-binding protein; Provisional 98.37
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 98.36
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 98.36
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 98.35
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 98.34
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 98.34
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 98.33
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 98.33
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 98.32
COG0488530 Uup ATPase components of ABC transporters with duplicat 98.32
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 98.31
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 98.31
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 98.31
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 98.3
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 98.3
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 98.29
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 98.29
PTZ002651467 multidrug resistance protein (mdr1); Provisional 98.29
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 98.28
PRK10789569 putative multidrug transporter membrane\ATP-binding com 98.28
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 98.27
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 98.26
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 98.25
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 98.24
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 98.24
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 98.23
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 98.22
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 98.22
TIGR01188 343 drrA daunorubicin resistance ABC transporter, ATP-bindi 98.21
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 98.21
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 98.21
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.2
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 98.19
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 98.19
KOG0059 885 consensus 98.19
PRK13542224 consensus 98.17
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 98.17
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 98.16
KOG0065 1391 consensus 98.15
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 98.15
KOG0927 614 consensus 98.15
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 98.14
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 98.13
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 98.1
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 98.08
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 98.07
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 98.06
COG0488 530 Uup ATPase components of ABC transporters with duplicat 98.04
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 98.04
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 98.04
COG1119257 ModF ABC-type molybdenum transport system, ATPase compo 98.02
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 98.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 97.99
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.95
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 97.94
KOG09331174 consensus 97.94
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.92
TIGR01186 372 proV glycine betaine/L-proline transport ATP binding su 97.91
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 97.88
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 97.88
COG1137243 YhbG ABC-type (unclassified) transport system, ATPase c 97.86
KOG0055 1228 consensus 97.85
COG1123539 ATPase components of various ABC-type transport systems 97.81
COG4694 758 Uncharacterized protein conserved in bacteria [Function 97.8
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 97.8
COG4988559 CydD ABC-type transport system involved in cytochrome b 97.79
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 97.77
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 97.77
KOG00181141 consensus 97.77
PRK13409590 putative ATPase RIL; Provisional 97.75
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 97.75
COG1135 339 AbcC ABC-type metal ion transport system, ATPase compon 97.72
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 97.69
COG4175 386 ProV ABC-type proline/glycine betaine transport system, 97.69
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 97.68
COG4615546 PvdE ABC-type siderophore export system, fused ATPase a 97.68
COG0411250 LivG ABC-type branched-chain amino acid transport syste 97.67
KOG0062582 consensus 97.66
COG4987573 CydC ABC-type transport system involved in cytochrome b 97.64
PRK13409 590 putative ATPase RIL; Provisional 97.61
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 97.59
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.58
COG1127263 Ttg2A ABC-type transport system involved in resistance 97.58
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 97.58
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 97.54
COG4133209 CcmA ABC-type transport system involved in cytochrome c 97.52
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 97.52
PTZ002431560 ABC transporter; Provisional 97.51
TIGR026801416 TIGR02680 conserved hypothetical protein TIGR02680; Int 97.49
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.49
COG4674249 Uncharacterized ABC-type transport system, ATPase compo 97.47
TIGR012711534 CFTR_protein cystic fibrosis transmembrane conductor re 97.47
KOG09961293 consensus 97.45
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 97.45
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 97.45
COG4559259 ABC-type hemin transport system, ATPase component [Inor 97.44
COG4161242 ArtP ABC-type arginine transport system, ATPase compone 97.37
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 97.36
COG4586325 ABC-type uncharacterized transport system, ATPase compo 97.3
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 97.15
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 97.14
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 97.12
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 97.12
KOG0057591 consensus 97.11
KOG0061 613 consensus 97.09
COG4717984 Uncharacterized conserved protein [Function unknown] 97.09
KOG09621294 consensus 97.07
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter; InterPro: I 97.07
COG4148 352 ModC ABC-type molybdate transport system, ATPase compon 97.03
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 97.02
TIGR006061328 rad50 rad50; InterPro: IPR004584 Rad50 is involved in r 97.01
COG4152300 ABC-type uncharacterized transport system, ATPase compo 97.0
COG1123 539 ATPase components of various ABC-type transport systems 96.96
COG0410237 LivF ABC-type branched-chain amino acid transport syste 96.93
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 96.92
COG2401593 ABC-type ATPase fused to a predicted acetyltransferase 96.72
TIGR02142 361 modC_ABC molybdate ABC transporter, ATP-binding protein 96.61
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 96.6
TIGR00954788 3a01203 Peroxysomal long chain fatty acyl transporter; 96.55
KOG0058716 consensus 96.5
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 96.49
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.46
COG4598256 HisP ABC-type histidine transport system, ATPase compon 96.42
TIGR01257 2272 rim_protein rim ABC transporter; InterPro: IPR005951 AB 96.39
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 96.34
TIGR03005256 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, AT 96.28
COG4525259 TauB ABC-type taurine transport system, ATPase componen 96.22
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 96.06
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 96.05
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 96.04
KOG0979 1072 consensus 99.63
KOG0933 1174 consensus 99.58
KOG0996 1293 consensus 99.51
KOG0964 1200 consensus 99.31
KOG09641200 consensus 99.13
TIGR021681191 SMC_prok_B chromosome segregation protein SMC; InterPro 98.99
TIGR021691202 SMC_prok_A chromosome segregation protein SMC; InterPro 98.75
COG3910233 Predicted ATPase [General function prediction only] 99.11
KOG00541381 consensus 96.5
PRK03918 882 chromosome segregation protein; Provisional 99.06
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 97.2
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 97.02
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.03
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00611 recf DNA replication and repair protein RecF; InterPro: IPR001238 All proteins in this family, including recF, for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN; InterPro: IPR004604 DNA repair protein RecN is thought to be DNA damage inducible and involved in recombinational processes Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information