254780767

254780767

lipid-A-disaccharide synthase

GeneID in NCBI database:8209773Locus tag:CLIBASIA_03290
Protein GI in NCBI database:254780767Protein Accession:YP_003065180.1
Gene range:+(494980, 496131)Protein Length:383aa
Gene description:lipid-A-disaccharide synthase
COG prediction:none
KEGG prediction:lpxB; lipid-A-disaccharide synthase (EC:2.4.1.182); K00748 lipid-A-disaccharide synthase [EC:2.4.1.182]
SEED prediction:Lipid-A-disaccharide synthase (EC 2.4.1.182)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380---
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
ccccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHcccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcccccEEEEEcccEEEEcccHHHHHHHHHHHHHHHccccHHHHHHcccccEEEEcccHHHHHHccccHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccccEEEEEcccHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccccccccHHHccccccHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHc
ccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEcccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcccccEEEEEcccEHHccHHHHHHHHHHHHHHHHHccccHHHHHHHcccccEEEccccHccccccccHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHccccccccHHHHccccHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHc
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYpinlvgvggpslqkeglvslfdfselsvIGIMQVVRHLPQFIFRINQTVELIvsskpdvllivdnpdfTHRVAKRVRkkmpnlpiinyvcpsvwaWREGRARKMCAYINQVISILPFEKEVMqrlggppttfvghplssspsiLEVYSQrnkqrntpsQWKKILllpgsraqEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVskwdispeiiidKEQKKQVFMTCNAAMAASGTVILELALcgipvvsiyksEWIVNFFIFYIKTWTcalpnlivdyplvpeyFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWdrmntkkpaghMAAEIVLQVLG
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVsskpdvllivdnPDFTHRVAKrvrkkmpnlpiinyVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQrnkqrntpsqwKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSlvtvssqenlVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
**SLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEV********NTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVY*********PSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
*NSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSVIGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVNFFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVLG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target383 lipid-A-disaccharide synthase [Candidatus Liberibacter
254781172731 NAD-dependent DNA ligase LigA [Candidatus Liberiba 0.034
>gi|254781172|ref|YP_003065585.1| NAD-dependent DNA ligase LigA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Back     alignment
 Score = 31.2 bits (69), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 54/108 (50%), Gaps = 11/108 (10%)

Query: 18  LAGDLI-KSLKEMVSYPINLVGVGG------PSL--QKEGLVSLFDFSELSVIGIMQVV- 67
           L GD+I +++ E    P N+  V        PS+   ++ + S  +  +L   G +Q + 
Sbjct: 603 LVGDIIAQAIVEFYQNPRNICAVEALLKEVSPSIGRHEKNVSSEIENKKLVFTGTLQKIQ 662

Query: 68  RHLPQ-FIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPN 114
           RH  Q ++ ++   V  I+S K D++++ DNP      A+++  K+ N
Sbjct: 663 RHKAQEYVTQLGAVVSAILSRKTDIIIVGDNPGSKLEKAQQLGVKIMN 710

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target383 lipid-A-disaccharide synthase [Candidatus Liberibacter
315121984391 lipid-A-disaccharide synthase [Candidatus Liberibacter 1 1e-176
218459271389 lipid-A-disaccharide synthase [Rhizobium etli Kim 5] Le 1 1e-126
327189233389 lipid A biosynthesis disaccharide synthase protein [Rhi 1 1e-123
190891619389 lipid A biosynthesis disaccharide synthase [Rhizobium e 1 1e-123
222085869393 lipid-A-disaccharide synthase [Agrobacterium radiobacte 1 1e-121
241204516392 lipid-A-disaccharide synthase [Rhizobium leguminosarum 1 1e-121
116251989392 lipid-A-disaccharide synthase [Rhizobium leguminosarum 1 1e-120
209549194389 lipid-A-disaccharide synthase [Rhizobium leguminosarum 1 1e-118
227821909394 lipid-A-disaccharide synthase [Sinorhizobium fredii NGR 1 1e-118
86357546389 lipid-A-disaccharide synthase [Rhizobium etli CFN 42] L 1 1e-118
>gi|315121984|ref|YP_004062473.1| lipid-A-disaccharide synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 391 Back     alignment and organism information
 Score =  620 bits (1600), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/382 (78%), Positives = 341/382 (89%)

Query: 1   MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSV 60
           M+S+KIAVIAGEISGD+LAGDLIKSLKEM+  PI+LVGVGG SLQKEGLVSLFDFSELS+
Sbjct: 1   MSSVKIAVIAGEISGDILAGDLIKSLKEMIPDPISLVGVGGSSLQKEGLVSLFDFSELSI 60

Query: 61  IGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY 120
           IGIMQV++HLP+FI+RINQTVELIV SKPDVLLIVDNPDFTHRVAKR+RK++P LPI+NY
Sbjct: 61  IGIMQVIKHLPRFIWRINQTVELIVLSKPDVLLIVDNPDFTHRVAKRIRKRLPQLPIVNY 120

Query: 121 VCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYS 180
           VCPSVWAWREGRAR M +YI+ VISILPFE EVM+RL GP T FVGHPLS+  ++LEVY+
Sbjct: 121 VCPSVWAWREGRARNMRSYIDHVISILPFEAEVMRRLEGPSTIFVGHPLSADSTVLEVYN 180

Query: 181 QRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENL 240
           ++  ++ T S+ KKILLLPGSRA+EI KILP F  A+ SLVKRNP F+FSLVTVSSQENL
Sbjct: 181 KQKNKQYTSSEQKKILLLPGSRAKEISKILPIFGKAMISLVKRNPTFKFSLVTVSSQENL 240

Query: 241 VRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVN 300
           VR IVS WDI PEII+ +EQKK++FM C+AAMAASGTVILELALCGIPVVS+YKS+WIVN
Sbjct: 241 VRRIVSGWDICPEIIVGEEQKKKLFMECDAAMAASGTVILELALCGIPVVSVYKSDWIVN 300

Query: 301 FFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENL 360
           F  FYIKTWTCALPNLI+DYP VPEYFN+MIRSEALVRWIERLS DT QRRAML  FE L
Sbjct: 301 FLSFYIKTWTCALPNLIIDYPAVPEYFNNMIRSEALVRWIERLSTDTCQRRAMLDSFETL 360

Query: 361 WDRMNTKKPAGHMAAEIVLQVL 382
           W  M+TK+PAG +AAE+VLQVL
Sbjct: 361 WSYMSTKRPAGQVAAEVVLQVL 382


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218459271|ref|ZP_03499362.1| lipid-A-disaccharide synthase [Rhizobium etli Kim 5] Length = 389 Back     alignment and organism information
>gi|327189233|gb|EGE56412.1| lipid A biosynthesis disaccharide synthase protein [Rhizobium etli CNPAF512] Length = 389 Back     alignment and organism information
>gi|190891619|ref|YP_001978161.1| lipid A biosynthesis disaccharide synthase [Rhizobium etli CIAT 652] Length = 389 Back     alignment and organism information
>gi|222085869|ref|YP_002544400.1| lipid-A-disaccharide synthase [Agrobacterium radiobacter K84] Length = 393 Back     alignment and organism information
>gi|241204516|ref|YP_002975612.1| lipid-A-disaccharide synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 392 Back     alignment and organism information
>gi|116251989|ref|YP_767827.1| lipid-A-disaccharide synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 392 Back     alignment and organism information
>gi|209549194|ref|YP_002281111.1| lipid-A-disaccharide synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 389 Back     alignment and organism information
>gi|227821909|ref|YP_002825879.1| lipid-A-disaccharide synthase [Sinorhizobium fredii NGR234] Length = 394 Back     alignment and organism information
>gi|86357546|ref|YP_469438.1| lipid-A-disaccharide synthase [Rhizobium etli CFN 42] Length = 389 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target383 lipid-A-disaccharide synthase [Candidatus Liberibacter
PRK00025380 PRK00025, lpxB, lipid-A-disaccharide synthase; Reviewed 1e-127
COG0763381 COG0763, LpxB, Lipid A disaccharide synthetase [Cell en 1e-101
pfam02684373 pfam02684, LpxB, Lipid-A-disaccharide synthetase 4e-59
TIGR00215385 TIGR00215, lpxB, lipid-A-disaccharide synthase 2e-49
PRK01021608 PRK01021, lpxB, lipid-A-disaccharide synthase; Reviewed 1e-37
PRK14089347 PRK14089, PRK14089, ipid-A-disaccharide synthase; Provi 1e-32
cd03799355 cd03799, GT1_amsK_like, This is a family of GT1 glycosy 0.002
TIGR03492396 TIGR03492, TIGR03492, conserved hypothetical protein 0.003
>gnl|CDD|178802 PRK00025, lpxB, lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>gnl|CDD|31106 COG0763, LpxB, Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|111570 pfam02684, LpxB, Lipid-A-disaccharide synthetase Back     alignment and domain information
>gnl|CDD|129319 TIGR00215, lpxB, lipid-A-disaccharide synthase Back     alignment and domain information
>gnl|CDD|167141 PRK01021, lpxB, lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>gnl|CDD|184498 PRK14089, PRK14089, ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>gnl|CDD|99972 cd03799, GT1_amsK_like, This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>gnl|CDD|163290 TIGR03492, TIGR03492, conserved hypothetical protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 383 lipid-A-disaccharide synthase [Candidatus Liberibacter
PRK00025382 lpxB lipid-A-disaccharide synthase; Reviewed 100.0
pfam02684373 LpxB Lipid-A-disaccharide synthetase. This is a family 100.0
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelope bio 100.0
PRK01021607 lpxB lipid-A-disaccharide synthase; Reviewed 100.0
TIGR00215393 lpxB lipid-A-disaccharide synthase; InterPro: IPR003835 100.0
TIGR03492396 conserved hypothetical protein. This protein family is 100.0
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 99.96
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferase, th 99.94
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 99.94
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine tr 99.93
TIGR01133368 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.9
PRK13609388 diacylglycerol glucosyltransferase; Provisional 99.88
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.87
COG4370412 Uncharacterized protein conserved in bacteria [Function 99.73
cd03817374 GT1_UGDG_like This family is most closely related to th 99.71
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltransfera 99.69
cd04962371 GT1_like_5 This family is most closely related to the G 99.69
cd03801374 GT1_YqgM_like This family is most closely related to th 99.68
cd03821375 GT1_Bme6_like This family is most closely related to th 99.67
cd03811353 GT1_WabH_like This family is most closely related to th 99.64
cd03820348 GT1_amsD_like This family is most closely related to th 99.64
cd03808359 GT1_cap1E_like This family is most closely related to t 99.63
cd04951360 GT1_WbdM_like This family is most closely related to th 99.62
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system associat 99.61
cd03807365 GT1_WbnK_like This family is most closely related to th 99.61
cd03796398 GT1_PIG-A_like This family is most closely related to t 99.6
cd03819355 GT1_WavL_like This family is most closely related to th 99.58
cd03800398 GT1_Sucrose_synthase This family is most closely relate 99.58
cd03814364 GT1_like_2 This family is most closely related to the G 99.58
cd03798377 GT1_wlbH_like This family is most closely related to th 99.58
cd03794394 GT1_wbuB_like This family is most closely related to th 99.55
cd03823359 GT1_ExpE7_like This family is most closely related to t 99.53
cd03822366 GT1_ecORF704_like This family is most closely related t 99.53
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol 99.51
PRK10307415 predicted glycosyl transferase; Provisional 99.47
cd03809365 GT1_mtfB_like This family is most closely related to th 99.47
cd03805392 GT1_ALG2_like This family is most closely related to th 99.46
cd03795357 GT1_like_4 This family is most closely related to the G 99.46
PRK05749423 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed 99.46
cd03825365 GT1_wcfI_like This family is most closely related to th 99.43
cd03784401 GT1_Gtf_like This family includes the Gtfs, a group of 99.4
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope 99.37
cd04955363 GT1_like_6 This family is most closely related to the G 99.33
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP 99.12
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP 99.11
cd03818396 GT1_ExpC_like This family is most closely related to th 99.08
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system associat 98.87
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell 98.81
COG1819406 Glycosyl transferases, related to UDP-glucuronosyltrans 98.77
TIGR01426429 MGT glycosyltransferase, MGT family; InterPro: IPR00632 98.62
TIGR02149416 glgA_Coryne glycogen synthase, Corynebacterium family; 98.51
TIGR00236380 wecB UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR 95.71
cd03812358 GT1_CapH_like This family is most closely related to th 99.65
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-h 99.45
pfam04007335 DUF354 Protein of unknown function (DUF354). Members of 99.34
PRK09922361 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-gala 99.3
COG1817346 Uncharacterized protein conserved in archaea [Function 99.17
COG0859334 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope 99.02
COG3980318 spsG Spore coat polysaccharide biosynthesis protein, pr 98.99
cd03802335 GT1_AviGT4_like This family is most closely related to 98.92
PRK10422352 lipopolysaccharide core biosynthesis protein; Provision 98.89
cd03804351 GT1_wbaZ_like This family is most closely related to th 98.82
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisional 98.79
PRK10964322 ADP-heptose:LPS heptosyl transferase I; Provisional 98.65
COG4671400 Predicted glycosyl transferase [General function predic 98.61
TIGR02095517 glgA glycogen/starch synthases, ADP-glucose type; Inter 96.91
TIGR02195361 heptsyl_trn_II lipopolysaccharide heptosyltransferase I 96.51
PRK10017426 putative pyruvyl transferase; Provisional 94.37
TIGR03590280 PseG pseudaminic acid biosynthesis-associated protein P 99.46
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyl 98.5
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [Cell 97.23
COG2327385 WcaK Polysaccharide pyruvyl transferase family protein 94.53
cd05844367 GT1_like_7 Glycosyltransferases catalyze the transfer o 99.35
pfam02350346 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase. This f 98.84
cd03806419 GT1_ALG11_like This family is most closely related to t 98.04
pfam04101167 Glyco_tran_28_C Glycosyltransferase family 28 C-termina 99.29
pfam00534172 Glycos_transf_1 Glycosyl transferases group 1. Mutation 98.94
PRK00654476 glgA glycogen synthase; Provisional 98.92
cd04949372 GT1_gtfA_like This family is most closely related to th 98.79
cd03813475 GT1_like_3 This family is most closely related to the G 98.56
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is most cl 98.06
pfam04464186 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glyc 97.6
cd03816415 GT1_ALG1_like This family is most closely related to th 96.29
KOG0853495 consensus 95.37
PHA01633335 putative glycosyl transferase group 1 93.71
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis, out 92.15
cd04946407 GT1_AmsK_like This family is most closely related to th 98.78
PRK10125405 predicted glycosyl transferase; Provisional 98.37
COG1887388 TagB Putative glycosyl/glycerophosphate transferases in 96.74
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases catal 98.34
pfam01075249 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltr 97.72
KOG1111426 consensus 96.77
pfam05159268 Capsule_synth Capsule polysaccharide biosynthesis prote 92.05
pfam00201501 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase. 97.71
pfam03033136 Glyco_transf_28 Glycosyltransferase family 28 N-termina 97.41
PRK11083229 DNA-binding response regulator CreB; Provisional 94.16
pfam06258308 DUF1022 Protein of unknown function (DUF1022). This fam 97.29
TIGR03609298 S_layer_CsaB polysaccharide pyruvyl transferase CsaB. T 95.85
cd04950373 GT1_like_1 Glycosyltransferases catalyze the transfer o 95.34
PHA01630333 putative group 1 glycosyl transferase 94.05
COG1165 566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 93.01
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and meta 91.66
PRK11337293 DNA-binding transcriptional repressor RpiR; Provisional 90.4
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>pfam02684 LpxB Lipid-A-disaccharide synthetase Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>PRK00726 murG N-acetylglucosaminyl transferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK12446 N-acetylglucosaminyl transferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; InterPro: IPR006009 The murG gene of Escherichia coli encodes the N-acetylglucosaminyltransferase, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, responsible for the final step in the formation of the lipid-linked disaccharide-pentapeptide subunit of peptidoglycan Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK10307 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family; InterPro: IPR006326 These sequences belong to the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family; InterPro: IPR011875 This entry describes Corynebacterium glutamicum GlgA and closely related proteins in other species Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>pfam04007 DUF354 Protein of unknown function (DUF354) Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type; InterPro: IPR011835 This family consists of glycogen (or starch) synthases that use ADP-glucose (2 Back     alignment and domain information
>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II; InterPro: IPR011910 This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis Back     alignment and domain information
>PRK10017 putative pyruvyl transferase; Provisional Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2327 WcaK Polysaccharide pyruvyl transferase family protein [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>pfam02350 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>pfam04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>pfam00534 Glycos_transf_1 Glycosyl transferases group 1 Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>pfam04464 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0853 consensus Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10125 predicted glycosyl transferase; Provisional Back     alignment and domain information
>COG1887 TagB Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>pfam01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase) Back     alignment and domain information
>KOG1111 consensus Back     alignment and domain information
>pfam05159 Capsule_synth Capsule polysaccharide biosynthesis protein Back     alignment and domain information
>pfam00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>pfam03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>pfam06258 DUF1022 Protein of unknown function (DUF1022) Back     alignment and domain information
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target383 lipid-A-disaccharide synthase [Candidatus Liberibacter
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentape 99.83
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two do 99.73
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediyne, t 99.71
2jjm_A394 Glycosyl transferase, group 1 family protein; anthrax, 99.65
3iaa_A416 CALG2; glycosyltransferase, calicheamicin, TDP, enediyn 99.63
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural genomic 99.6
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); GT4 gl 99.57
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydrate, g 99.57
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allost 99.55
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural genomic 99.55
3c48_A438 Predicted glycosyltransferases; retaining glycosyltrans 99.49
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.20A {P 99.47
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic resi 99.43
1rrv_A416 Glycosyltransferase GTFD; GT-B, rossmann fold; HET: DVV 99.37
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; tran 99.35
3fro_A439 GLGA glycogen synthase; glycosyltransferase family, UDP 99.3
2p6p_A384 Glycosyl transferase; GT-B family, X-RAY-diffraction,ur 99.26
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; vancomyc 99.22
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural genomic 99.2
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycola 99.18
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mannose, 99.16
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransferase, 98.85
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glycosyltr 98.43
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino monom 99.4
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases, xan 98.01
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold, ros 99.33
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural geno 99.27
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1. 98.53
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobaci 98.06
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fold, r 99.22
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80A {Ha 98.69
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 5 UD 98.67
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WINE, ca 98.49
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, OGT, 98.14
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosyltran 97.91
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta protein 97.1
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, rossm 96.72
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni 99.09
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family GT-4, 98.23
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation 98.65
3l7i_A729 Teichoic acid biosynthesis protein F; GT-B fold, monoto 97.49
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransferase, 96.68
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen synthase 95.49
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; ross 92.64
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural genomics 91.67
1zh8_A340 Oxidoreductase; TM0312, structural genomics, joint cent 91.53
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, structural 91.1
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhi 90.56
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
Probab=99.83  E-value=8.1e-18  Score=136.12  Aligned_cols=339  Identities=15%  Similarity=0.176  Sum_probs=203.1

Q ss_pred             CCCC--EEEEEECCCCHHHHHH-HHHHHHHHHCCCCEEEEEECC----HHHHHCCCEEE-ECHHHCCEEEHHHHHHHHHH
Q ss_conf             9874--5999976821478999-999999973899839999717----89994788065-04445311013674664599
Q gi|254780767|r    1 MNSL--KIAVIAGEISGDLLAG-DLIKSLKEMVSYPINLVGVGG----PSLQKEGLVSL-FDFSELSVIGIMQVVRHLPQ   72 (383)
Q Consensus         1 m~~m--ki~i~aGE~SGD~~~a-~li~~Lk~~~~~~~~~~giGG----~~m~~~G~~~~-~~~~~l~v~G~~evl~~~~~   72 (383)
                      |+++  ||+|+||.+.|++..| .|+++|+++ +.++.|.+.+.    +...+.|.+.. .++..+.--|+...+.....
T Consensus         2 ~~~~~kkili~t~GtGGHi~~a~ala~~L~~~-g~eV~~i~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~   80 (364)
T 1f0k_A            2 MSGQGKRLMVMAGGTGGHVFPGLAVAHHLMAQ-GWQVRWLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKALIAAPLR   80 (364)
T ss_dssp             -----CEEEEECCSSHHHHHHHHHHHHHHHTT-TCEEEEEECTTSTHHHHGGGGTCEEEECCCCCCTTCCHHHHHTCHHH
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-CCEEEEEEECCCCHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHH
T ss_conf             99999769998689799999999999999968-89899998388005431221399579997788687772899999999


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEE-CHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCH
Q ss_conf             99999999861001288868985-11776579999866301346311110022110036635579999986401567742
Q gi|254780767|r   73 FIFRINQTVELIVSSKPDVLLIV-DNPDFTHRVAKRVRKKMPNLPIINYVCPSVWAWREGRARKMCAYINQVISILPFEK  151 (383)
Q Consensus        73 ~~~~~~~~~~~i~~~~Pd~vi~i-D~pgFnl~lak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~d~~~~ifpFE~  151 (383)
                      ..+.+......+...+||.++.+ +++.+-  .+...+.  .++|++.+. ++.|.  .+-.+....+.|.+..-     
T Consensus        81 ~~~~~~~~~~i~~~~~~~~i~~~~~~~~~~--~~~~a~~--~~ip~~~~~-~~~~~--~~~~~~~~~~~~~~~~~-----  148 (364)
T 1f0k_A           81 IFNAWRQARAIMKAYKPDVVLGMGGYVSGP--GGLAAWS--LGIPVVLHE-QNGIA--GLTNKWLAKIATKVMQA-----  148 (364)
T ss_dssp             HHHHHHHHHHHHHHHCCSEEEECSSTTHHH--HHHHHHH--TTCCEEEEE-CSSSC--CHHHHHHTTTCSEEEES-----
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCCH--HHHHHHH--CCCCEEEEE-ECEEC--CHHHHHHHHHCCEEEEC-----
T ss_conf             999999999999864777799846755686--9999753--588789985-12023--51477665414433210-----


Q ss_pred             HHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             23200255314763882112210013558889761876556505998538743012305111899987640273512620
Q gi|254780767|r  152 EVMQRLGGPPTTFVGHPLSSSPSILEVYSQRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSL  231 (383)
Q Consensus       152 ~~f~k~~~~~~~fVGHPl~d~~~~~~~~~~~~~~~~~~~~~~~I~llPGSR~~EI~~~lP~~l~~~~~l~~~~~~~~~~i  231 (383)
                        +... .....++|+|....+.....   ...+....++...+.++.||..+...  ...+.+.+..+...   ...++
T Consensus       149 --~~~~-~~~~~~~g~~~~~~~~~~~~---~~~~~~~~~~~~~il~~~gs~G~~~~--~~~~~~~~~~l~~~---~~~v~  217 (364)
T 1f0k_A          149 --FPGA-FPNAEVVGNPVRTDVLALPL---PQQRLAGREGPVRVLVVGGSQGARIL--NQTMPQVAAKLGDS---VTIWH  217 (364)
T ss_dssp             --STTS-SSSCEECCCCCCHHHHTSCC---HHHHHTTCCSSEEEEEECTTTCCHHH--HHHHHHHHHHHGGG---EEEEE
T ss_pred             --CCCC-CCCCEEECCCCCCHHHCCCH---HHHHHCCCCCCCCCCCCCCCCCCHHH--HHHHHHHHHHHHCC---CEEEE
T ss_conf             --2344-55540557865412210214---55430246787531324677320225--68899999985026---55999


Q ss_pred             CCC-CCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCHHHHH-HHHHHCCCEEEE-CCCCC-CEEEEEE-CC
Q ss_conf             166-3368899999960488850552055203578876355233115668-887627530254-05774-1000010-24
Q gi|254780767|r  232 VTV-SSQENLVRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVIL-ELALCGIPVVSI-YKSEW-IVNFFIF-YI  306 (383)
Q Consensus       232 ~~~-~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~sd~ai~~SGTaTL-E~al~g~P~IV~-Yk~~~-lt~~i~~-li  306 (383)
                      ... ................+..+.-...+..++|+.||++|+.+|..|+ |++.+|+|+|++ +.... -....+. +.
T Consensus       218 ~~~~~~~~~~~~~~~~~~~~~~~v~~f~~~m~~lm~~aDlvIt~aG~~Ti~E~l~~g~P~I~iP~~~~~~~Q~~NA~~l~  297 (364)
T 1f0k_A          218 QSGKGSQQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQHKDRQQYWNALPLE  297 (364)
T ss_dssp             ECCTTCHHHHHHHHHHTTCTTSEEESCCSCHHHHHHHCSEEEECCCHHHHHHHHHHTCCEEECCCCCTTCHHHHHHHHHH
T ss_pred             EECCCHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHCCEEEECCCCCHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             94441377787776640465415312787799999846777745884058899863898899807998776999999999


Q ss_pred             CCCCEEEEHHHCCCCCCCHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             6761023024407842612420548989999999998449899999999999999983899998999999999861
Q gi|254780767|r  307 KTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENLWDRMNTKKPAGHMAAEIVLQVL  382 (383)
Q Consensus       307 k~~~i~LpNii~~~~ivPEliQ~~~~~~~i~~~~~~ll~d~~~r~~~~~~~~~~~~~Lg~~~~a~~~AA~~I~~~L  382 (383)
                      +.-. +        .+++   |++.+++.+.+.+..+  |++.+.+|.++++    +++.+. +.++.|+.|.++.
T Consensus       298 ~~G~-~--------~~i~---~~~l~~e~l~~~l~~l--~~~~l~~m~~~~~----~~~~~~-~~~~I~~~I~~l~  354 (364)
T 1f0k_A          298 KAGA-A--------KIIE---QPQLSVDAVANTLAGW--SRETLLTMAERAR----AASIPD-ATERVANEVSRVA  354 (364)
T ss_dssp             HTTS-E--------EECC---GGGCCHHHHHHHHHTC--CHHHHHHHHHHHH----HTCCTT-HHHHHHHHHHHHH
T ss_pred             HCCC-E--------EEEC---HHCCCHHHHHHHHHHH--CHHHHHHHHHHHH----CCCCCC-HHHHHHHHHHHHH
T ss_conf             7899-9--------9905---2109999999999863--9999999999987----258988-9999999999999



>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} Back     alignment and structure
>3iaa_A CALG2; glycosyltransferase, calicheamicin, TDP, enediyne, TR; HET: TYD; 2.50A {Micromonospora echinospora} Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, binary complex; HET: GDP; 2.40A {Mycobacterium smegmatis str} PDB: 2gej_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate assisted catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xmp_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, rossmann fold; HET: DVV TYD; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure