254780768

254780768

hypothetical protein CLIBASIA_03295

GeneID in NCBI database:8209774Locus tag:CLIBASIA_03295
Protein GI in NCBI database:254780768Protein Accession:YP_003065181.1
Gene range:+(494138, 494983)Protein Length:281aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09949 hypothetical protein
SEED prediction:Protein of unknown function DUF1009 clustered with KDO2-Lipid A biosynthesis genes
Pathway involved in KEGG:not defined
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
cccEEEEEccccHHHHHHHHHHHccccEEEEEEcccccHHHHccccEEEEHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEEccccHHHHHHHHHHHcccccccccccEEEEEEcccccccccccccccHHHHHHHHHHcccEEEEEcccEEEEcHHHHHHHHHHcccEEEEEEccccc
cccEEEEEcccccHHHHHHHHHHccccEEEEEEcccccHHHHcccccEEEHHHHHHHHHHHHHccccEEEEEccccccccHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEcHHHHcHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEEEccccHHHHHHHHHHHHccccccccccEEEEEccccccccccccccccHHHHHHHHHccccEEEEEcccEEEEcHHHHHHHHHHcccEEEEEcccccc
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEcsfdwqdfecrelplgdfcVLRSILHQYNIGRIVVagaidrrpnvqDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGslgtcvpnrdVKRDILAAMKSAEALseldvgqsavsIGGRVValegiegtdSMLQRIVDCRnngrilagkSGVLVKMCKSQQdmradlpsigaKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCgidrefai
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVvagaidrrpnVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEalseldvgqsavSIGGRVVALEGIEGTDSMLQRIVDCRNNgrilagksgVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVkkhadeagifvcgidrefai
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSlvlekelvkkHADEAGIFVCGIDREFAI
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCR******AGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA*
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
*KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target281 hypothetical protein CLIBASIA_03295 [Candidatus Liberib
315121985281 hypothetical protein CKC_01175 [Candidatus Liberibacter 1 1e-133
116251988293 hypothetical protein RL2232 [Rhizobium leguminosarum bv 1 4e-75
190891618293 hypothetical protein RHECIAT_CH0002021 [Rhizobium etli 1 1e-73
241204515293 hypothetical protein Rleg_1787 [Rhizobium leguminosarum 1 1e-73
222085868293 hypothetical protein Arad_2233 [Agrobacterium radiobact 1 3e-73
86357545293 hypothetical protein RHE_CH01924 [Rhizobium etli CFN 42 1 3e-73
209549193293 hypothetical protein Rleg2_1594 [Rhizobium leguminosaru 1 3e-73
222148851290 hypothetical protein Avi_2512 [Agrobacterium vitis S4] 1 7e-71
150396361295 hypothetical protein Smed_1142 [Sinorhizobium medicae W 1 3e-69
325292748293 hypothetical protein AGROH133_05895 [Agrobacterium sp. 1 3e-67
>gi|315121985|ref|YP_004062474.1| hypothetical protein CKC_01175 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 281 Back     alignment and organism information
 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/281 (82%), Positives = 257/281 (91%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           MKRLLIIAGSG+LPYYVAKAARL NDEPVIASVLNECSFDW+DFE + LPLGD CVLRSI
Sbjct: 1   MKRLLIIAGSGILPYYVAKAARLNNDEPVIASVLNECSFDWKDFESQALPLGDLCVLRSI 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L+QYNIGRIVVAGAI RRP++QDLCFSIKDS +I K+IWQLVSGG+AAILKA ID LE Y
Sbjct: 61  LNQYNIGRIVVAGAISRRPSIQDLCFSIKDSFKIPKLIWQLVSGGDAAILKAVIDFLEGY 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GVSVVGAHE+VP+LL Q GSLG+C+P + +KRDI +AMKSAEALS+LD+GQSAVS+GGRV
Sbjct: 121 GVSVVGAHEVVPDLLTQKGSLGSCIPTKGIKRDIFSAMKSAEALSDLDIGQSAVSVGGRV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEGIEGTDSMLQRIVDCR NG+IL GKSGVLVKM KSQQDMRADLPSIG  TVQNVIK
Sbjct: 181 VALEGIEGTDSMLQRIVDCRKNGKILVGKSGVLVKMFKSQQDMRADLPSIGLMTVQNVIK 240

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGL+GIALE GKSL+LEK+LVKK ADEAGIF+ GIDREF I
Sbjct: 241 AGLSGIALEYGKSLILEKDLVKKSADEAGIFIYGIDREFKI 281


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116251988|ref|YP_767826.1| hypothetical protein RL2232 [Rhizobium leguminosarum bv. viciae 3841] Length = 293 Back     alignment and organism information
>gi|190891618|ref|YP_001978160.1| hypothetical protein RHECIAT_CH0002021 [Rhizobium etli CIAT 652] Length = 293 Back     alignment and organism information
>gi|241204515|ref|YP_002975611.1| hypothetical protein Rleg_1787 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 293 Back     alignment and organism information
>gi|222085868|ref|YP_002544399.1| hypothetical protein Arad_2233 [Agrobacterium radiobacter K84] Length = 293 Back     alignment and organism information
>gi|86357545|ref|YP_469437.1| hypothetical protein RHE_CH01924 [Rhizobium etli CFN 42] Length = 293 Back     alignment and organism information
>gi|209549193|ref|YP_002281110.1| hypothetical protein Rleg2_1594 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 293 Back     alignment and organism information
>gi|222148851|ref|YP_002549808.1| hypothetical protein Avi_2512 [Agrobacterium vitis S4] Length = 290 Back     alignment and organism information
>gi|150396361|ref|YP_001326828.1| hypothetical protein Smed_1142 [Sinorhizobium medicae WSM419] Length = 295 Back     alignment and organism information
>gi|325292748|ref|YP_004278612.1| hypothetical protein AGROH133_05895 [Agrobacterium sp. H13-3] Length = 293 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target281 hypothetical protein CLIBASIA_03295 [Candidatus Liberib
pfam06230212 pfam06230, DUF1009, Protein of unknown function (DUF100 9e-55
COG3494279 COG3494, COG3494, Uncharacterized protein conserved in 1e-66
>gnl|CDD|148062 pfam06230, DUF1009, Protein of unknown function (DUF1009) Back     alignment and domain information
>gnl|CDD|33297 COG3494, COG3494, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 281 hypothetical protein CLIBASIA_03295 [Candidatus Liberib
COG3494279 Uncharacterized protein conserved in bacteria [Function 100.0
pfam06230212 DUF1009 Protein of unknown function (DUF1009). Family o 100.0
PRK00881514 purH bifunctional phosphoribosylaminoimidazolecarboxami 97.42
COG0138515 PurH AICAR transformylase/IMP cyclohydrolase PurH (only 96.98
PRK07106391 5-aminoimidazole-4-carboxamide ribonucleotide transform 96.71
COG2910211 Putative NADH-flavin reductase [General function predic 94.8
PRK05647200 purN phosphoribosylglycinamide formyltransferase; Revie 94.61
TIGR00639215 PurN phosphoribosylglycinamide formyltransferase; Inter 94.03
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2; Val 92.01
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 90.45
>COG3494 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam06230 DUF1009 Protein of unknown function (DUF1009) Back     alignment and domain information
>PRK00881 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional Back     alignment and domain information
>COG0138 PurH AICAR transformylase/IMP cyclohydrolase PurH (only IMP cyclohydrolase domain in Aful) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07106 5-aminoimidazole-4-carboxamide ribonucleotide transformylase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase; InterPro: IPR004607 This family describes phosphoribosylglycinamide formyltransferase (GAR transformylase), one of several proteins found in formyltransferase Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target281 hypothetical protein CLIBASIA_03295 [Candidatus Liberib
1zcz_A464 Bifunctional purine biosynthesis protein PURH; TM1249; 97.34
1g8m_A593 Aicar transformylase-IMP cyclohydrolase; homodimer, 2 f 96.73
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferase 2, 93.34
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglycinami 92.64
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, bio 92.62
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dimer, h 92.26
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99.5) (C 91.76
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase; alp 91.75
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics consor 91.71
1pfk_A320 Phosphofructokinase; transferase(phosphotransferase); H 90.37
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase subunit 90.92
>1zcz_A Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} SCOP: c.24.1.3 c.97.1.4 Back     alignment and structure
Probab=97.34  E-value=0.0037  Score=40.24  Aligned_cols=111  Identities=17%  Similarity=0.146  Sum_probs=81.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHH------HHHHHHHHHHHCCCCCCCCEE
Q ss_conf             33455465323478899899999973326722599981974889625342179------999999754312345667718
Q gi|254780768|r  139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDS------MLQRIVDCRNNGRILAGKSGV  212 (281)
Q Consensus       139 G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~------mi~R~~~~~~~~~~~~~~~~i  212 (281)
                      -+.|.++|++++++|+.++|++++..-+=-|   |+++|+..+++=+=+ |+.      .++++++        ..+|++
T Consensus       340 ~~vt~~~pt~~e~~dL~FAwkv~K~vkSNAI---v~akn~~tiGIGaGQ-~sRvds~~iA~~kA~~--------~~~g~v  407 (464)
T 1zcz_A          340 ELVVGEPLSEKELEDLEFAYRVVEGAKSNAV---LIAKDGVTVGIGSGQ-PSRKRAAWIATVMAGE--------KAKGAV  407 (464)
T ss_dssp             EEEESCCCCHHHHHHHHHHHHHHHHSCSSCE---EEEETTEEEEEECSC-SSHHHHHHHHHHHHGG--------GGTTCE
T ss_pred             CEEECCCCCHHHHCCCCHHHHHHCCCCCCCE---EEEECCEEEEECCCC-CCHHHHHHHHHHHHCC--------CCCCEE
T ss_conf             1010578883331450058866453542648---996098699758886-5779999999998353--------027869


Q ss_pred             EEEECCCCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEE
Q ss_conf             99934888753121066279999999984990999973977998589999999987968999
Q gi|254780768|r  213 LVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       213 lvK~~K~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g  274 (281)
                      +.=      |==  +|-  ++.|+.++++|.+.|+ +.|+++  .-+++|+.||++||..+=
T Consensus       408 ~aS------DAF--FPF--~D~i~~aa~~Gv~~Ii-qPGGSi--rD~evI~aane~gi~m~f  456 (464)
T 1zcz_A          408 AAS------DAF--FPF--PDSLEILAQAGVKAVV-APLGSI--RDEEVIEKARELGITFYK  456 (464)
T ss_dssp             EEE------SSC--CSS--HHHHHHHHHTTCCEEE-ECCCCT--THHHHHHHHHHHTCEEEE
T ss_pred             EEE------CCC--CCC--CHHHHHHHHCCCEEEE-CCCCCC--CHHHHHHHHHHHCCEEEE
T ss_conf             995------668--887--5489999983994998-798742--519999999974978998



>1g8m_A Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} SCOP: c.24.1.3 c.97.1.4 PDB: 1thz_A* 2b1g_A* 2b1i_A* 2iu0_A* 2iu3_A* 1m9n_A* 1oz0_A* 1pkx_A* 1p4r_A* 1pl0_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide formyl transferase; purine ribonucleotide biosynthesis, PURT; HET: ADP; 1.70A {Pyrococcus horikoshii OT3} PDB: 2czg_A* Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99.5) (CM) and prephenate dehydrogenase...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1pfk_A Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} SCOP: c.89.1.1 PDB: 2pfk_A Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target281 hypothetical protein CLIBASIA_03295 [Candidatus Liberib
d1zcza2295 AICAR transformylase domain of bifunctional purine bios 97.71
d1g8ma2393 AICAR transformylase domain of bifunctional purine bios 93.68
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N-domai 92.26
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) [Tax 90.21
>d1zcza2 c.97.1.4 (A:158-452) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Cytidine deaminase-like
superfamily: Cytidine deaminase-like
family: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC
domain: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC
species: Thermotoga maritima [TaxId: 2336]
Probab=97.71  E-value=0.0011  Score=42.22  Aligned_cols=112  Identities=16%  Similarity=0.071  Sum_probs=83.3

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCH-----HHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             334554653234788998999999733267225999819748896253421-----799999997543123456677189
Q gi|254780768|r  139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGT-----DSMLQRIVDCRNNGRILAGKSGVL  213 (281)
Q Consensus       139 G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGT-----D~mi~R~~~~~~~~~~~~~~~~il  213 (281)
                      -+.|+++|++++++|+.+||.+++..-+=-|   |+++|+..+++=+=+=-     .-.++++++        ..+|+|+
T Consensus       171 ~~vT~~~pt~~e~~dL~FA~~v~k~vkSNAI---vlakn~~tiGiGaGQ~sRvda~~iA~~ka~~--------~~~g~v~  239 (295)
T d1zcza2         171 ELVVGEPLSEKELEDLEFAYRVVEGAKSNAV---LIAKDGVTVGIGSGQPSRKRAAWIATVMAGE--------KAKGAVA  239 (295)
T ss_dssp             EEEESCCCCHHHHHHHHHHHHHHHHSCSSCE---EEEETTEEEEEECSCSSHHHHHHHHHHHHGG--------GGTTCEE
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCCE---EEECCCCEEEEECCCHHHHHHHHHHHHHHHH--------HHCCCEE
T ss_conf             4774476643343437999999864576627---9962881787504322367776666765445--------4248279


Q ss_pred             EEECCCCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEE
Q ss_conf             9934888753121066279999999984990999973977998589999999987968999
Q gi|254780768|r  214 VKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       214 vK~~K~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g  274 (281)
                      .          -|=.-=-+++|+.++++|++.|+ +.|+++  .-+++|+.||++||..+=
T Consensus       240 a----------SDAFFPF~D~i~~a~~~Gv~aIi-qPGGSi--rD~evI~aan~~gi~m~f  287 (295)
T d1zcza2         240 A----------SDAFFPFPDSLEILAQAGVKAVV-APLGSI--RDEEVIEKARELGITFYK  287 (295)
T ss_dssp             E----------ESSCCSSHHHHHHHHHTTCCEEE-ECCCCT--THHHHHHHHHHHTCEEEE
T ss_pred             E----------CCCCCCCCHHHHHHHHCCCEEEE-CCCCCC--CCHHHHHHHHHHCCEEEE
T ss_conf             7----------24576885689999985994999-899864--639999999985978998



>d1g8ma2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target281 hypothetical protein CLIBASIA_03295 [Candidatus Liberib
1zcz_A_336-464129 Bifunctional purine biosynthesis protein PURH; TM1 97.02
1g8m_A_398-593196 Aicar transformylase-IMP cyclohydrolase; homodimer 95.95
3pfk_A_1-131_251-305186 Phosphofructokinase; transferase(phosphotransferas 94.61
1zxx_A_1-131_253-303182 6-phosphofructokinase; allosteric regulation, lact 93.71
1pfk_A_1-132_254-306185 Phosphofructokinase; transferase(phosphotransferas 90.71
3doj_A_1-184184 AT3G25530, dehydrogenase-like protein; gamma-hydro 90.62
2dwc_A_1-108108 PH0318, 433AA long hypothetical phosphoribosylglyc 94.06
1kjq_A_1-125125 GART 2, phosphoribosylglycinamide formyltransferas 93.6
3eth_A_1-5353 Phosphoribosylaminoimidazole carboxylase ATPase su 90.18
>1zcz_A (A:336-464) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} Back     alignment and structure
Probab=97.02  E-value=0.013  Score=37.67  Aligned_cols=117  Identities=17%  Similarity=0.111  Sum_probs=78.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECC
Q ss_conf             33455465323478899899999973326722599981974889625342179999999754312345667718999348
Q gi|254780768|r  139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCK  218 (281)
Q Consensus       139 G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~~~~~~~~~~~~~ilvK~~K  218 (281)
                      .+.|.++|++++++|..++|.+.+..-+--|   +++.+|..+++=+-+=.-.-=.|.+- .+.+.  .-.|.++.    
T Consensus         5 ~vvt~~~p~~~~~~dl~Fa~~v~k~~kSNAI---~~~~~g~~~gig~Gq~srv~~~~~a~-~~a~~--~l~g~vla----   74 (129)
T 1zcz_A            5 ELVVGEPLSEKELEDLEFAYRVVEGAKSNAV---LIAKDGVTVGIGSGQPSRKRAAWIAT-VMAGE--KAKGAVAA----   74 (129)
T ss_dssp             EEEESCCCCHHHHHHHHHHHHHHHHSCSSCE---EEEETTEEEEEECSCSSHHHHHHHHH-HHHGG--GGTTCEEE----
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCE---EEECCCCEEEECCCCCCHHHHHHHHH-HHHHH--HCCCEEEE----
T ss_conf             0134789866666769999999976786757---99639938976889667799999999-98510--21787999----


Q ss_pred             CCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEE
Q ss_conf             88753121066279999999984990999973977998589999999987968999
Q gi|254780768|r  219 SQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       219 ~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g  274 (281)
                            -|=.-=-+++|+.++++|.+.|+ +.|+++  --+++|+.||++||.++=
T Consensus        75 ------SDAFFPF~D~v~~A~~~GV~~Ii-qPgGSi--rD~evI~aane~gi~mvf  121 (129)
T 1zcz_A           75 ------SDAFFPFPDSLEILAQAGVKAVV-APLGSI--RDEEVIEKARELGITFYK  121 (129)
T ss_dssp             ------ESSCCSSHHHHHHHHHTTCCEEE-ECCCCT--THHHHHHHHHHHTCEEEE
T ss_pred             ------ECCCCCCCHHHHHHHHCCCEEEE-CCCCCC--CHHHHHHHHHHHCCEEEE
T ss_conf             ------45687875589999983994999-798743--619999999975988998



>1g8m_A (A:398-593) Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} Back     alignment and structure
>3pfk_A (A:1-131,A:251-305) Phosphofructokinase; transferase(phosphotransferase); 2.40A {Bacillus stearothermophilus} Back     alignment and structure
>1zxx_A (A:1-131,A:253-303) 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1pfk_A (A:1-132,A:254-306) Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} Back     alignment and structure
>3doj_A (A:1-184) AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2dwc_A (A:1-108) PH0318, 433AA long hypothetical phosphoribosylglycinamide formyl transferase; purine ribonucleotide biosynthesis, PURT; HET: ADP; 1.70A {Pyrococcus horikoshii OT3} PDB: 2czg_A* Back     alignment and structure
>1kjq_A (A:1-125) GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} Back     alignment and structure
>3eth_A (A:1-53) Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} Back     alignment and structure