255764481

255764481

UDP-N-acetylglucosamine acyltransferase

GeneID in NCBI database:8209775Locus tag:CLIBASIA_03300
Protein GI in NCBI database:255764481Protein Accession:YP_003065182.2
Gene range:+(493314, 494129)Protein Length:271aa
Gene description:UDP-N-acetylglucosamine acyltransferase
COG prediction:none
KEGG prediction:lpxA; UDP-N-acetylglucosamine acyltransferase (EC:2.3.1.129); K00677 UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
SEED prediction:Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPLSNWGNSKK
ccEEccccEEcccEEEccccEEccccEEccccEEccccEEccccEEccccEEEcccEEccccEEEcccEEccccccccccccccEEEEccccccccccEEccccccccccEEEccccEEccccEEccccEEccccEEEEccEEccccEEccccEEccccEEEccEEEccccEEccccEEccccccccEEEccccEEEcccHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccc
cccccccccccccEEEccccEEcccEEEccEEEEcccEEEcccEEEccEEEEEccEEEccccEEEEEEEEcccccccccccccEEEEEccccEEEEEEEEEccccccccEEEEccccEEEEEEEEccccEEccEEEEEEccEEcEEEEEccEEEEEcccHHEEEEEEccHEEHccHHHHHcccccEEEEcccccccccccHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHcccccEEEEcccccc
msrmgnnpiihplalveegavigpnsligpfccvgseveiGAGVELISHCVVAgktkigdftkvfpmavlggdtqskyhnFVGTellvgkkcviregvtinrgtveyggktivgdnnfFLANShvahdcklgngivlsnnVMIAGHvivddrvvfgggsavhqFTRIGKYafiggmtgvvhdvipygilngnpgalrgVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSiyknagaireqnvscpevsDIINFIFadrkrplsnwgnskk
msrmgnnpIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTellvgkkcviregvtinrgtveyggkTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIfadrkrplsnwgnskk
MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPLSNWGNSKK
***********PLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADR************
MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPL********
***MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPLSNWG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPLSNWGNSKK
MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPLSNWGNSKK
MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVHDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQNVSCPEVSDIINFIFADRKRPLSNWGNSKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target271 UDP-N-acetylglucosamine acyltransferase [Candidatus Lib
254780771347 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 1e-09
254780942442 UDP-N-acetylglucosamine pyrophosphorylase protein 0.005
254780942442 UDP-N-acetylglucosamine pyrophosphorylase protein 0.017
254781223110 intrrupted gp229, phage associated protein [Candid 0.026
>gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Back     alignment
 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 12/186 (6%)

Query: 9   IIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMA 68
           +I P+A+V  G  IG  + +GP   +G+ V IG    + +   +   + IG+   +    
Sbjct: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGV 194

Query: 69  VLGGDT------QSKYHNFVGT-ELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLA 121
            +G D        S  H  V    +++  K  I     I+RGT++    TI+G+N     
Sbjct: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID---DTIIGENTKIDN 251

Query: 122 NSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVH 181
              + H+  +G G ++ + V IAG   + D V+ GG   +  + +IG    I   +GV+ 
Sbjct: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311

Query: 182 DVIPYG 187
           D IP G
Sbjct: 312 D-IPAG 316

>gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 442 Back     alignment
 Score = 33.1 bits (74), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 23/136 (16%)

Query: 18  EGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSK 77
           EG  IG  ++IGPF  +  E  I   V            +IG+F +V    +  G ++  
Sbjct: 301 EGVHIGKKTIIGPFARIRQETTIEKNV------------RIGNFCEVKKATIKEG-SKIN 347

Query: 78  YHNFVGTELLVGKKCVIREG-VTIN-RGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGI 135
           + ++VG + +VGK   I  G +T N  GT +Y  KT + +N F  +NS +     +G G 
Sbjct: 348 HLSYVG-DSVVGKNVNIGAGTITCNYDGTHKY--KTHINENAFIGSNSSLIAPITIGQGT 404

Query: 136 VLSNNVMIAGHVIVDD 151
            ++     +G +I  D
Sbjct: 405 YVA-----SGSIITQD 415

>gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 442 Back     alignment
 Score = 31.6 bits (70), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 48/124 (38%), Gaps = 6/124 (4%)

Query: 4   MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTK 63
           +G   II P A + +   I  N  IG FC V  +  I  G + I+H    G + +G    
Sbjct: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEV-KKATIKEGSK-INHLSYVGDSVVGKNVN 362

Query: 64  VFPMAVLGG-DTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGD---NNFF 119
           +    +    D   KY   +     +G    +   +TI +GT    G  I  D   N+  
Sbjct: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422

Query: 120 LANS 123
            A S
Sbjct: 423 FARS 426

>gi|254781223|ref|YP_003065636.1| intrrupted gp229, phage associated protein [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Back     alignment
 Score = 30.8 bits (68), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 4   MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTK 63
           M +N ++   A V + A +  N+ +  F  V S  E+        +  V    K+G + K
Sbjct: 1   MYDNAVVRDCATVIDDARVSGNASVSRFAQVKSNAEVS------DNTYVRDNAKVGGYAK 54

Query: 64  VFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIV 113
           V   A +GG+   +    VG +  V    VI     + RG    GG T+V
Sbjct: 55  VSGNASVGGNAIVRDTAEVGGDAFVIGFTVISGNARV-RGNAVVGGDTVV 103

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target271 UDP-N-acetylglucosamine acyltransferase [Candidatus Lib
170785431363 lipid A biosynthesis acyl-[acyl-carrier-protein]--UDP-N 1 1e-153
315121986268 UDP-N-acetylglucosamine acyltransferase [Candidatus Lib 1 1e-108
227821907270 UDP-N-acetylglucosamine acyltransferase [Sinorhizobium 1 1e-88
190891617272 lipid A biosynthesis acyl-[acyl-carrier-protein]-UDP-N- 1 1e-87
327189232272 lipid A biosynthesis acyl-[acyl-carrier-protein]-UDP-N- 1 2e-87
241204514272 UDP-N-acetylglucosamine acyltransferase [Rhizobium legu 1 9e-87
209549192272 UDP-N-acetylglucosamine acyltransferase [Rhizobium legu 1 2e-86
86357544272 UDP-N-acetylglucosamine acyltransferase [Rhizobium etli 1 3e-86
116251987272 UDP-N-acetylglucosamine acyltransferase [Rhizobium legu 1 4e-86
222085867271 acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine O- 1 1e-85
>gi|170785431|gb|ACB37711.1| lipid A biosynthesis acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase [Candidatus Liberibacter asiaticus] Length = 363 Back     alignment and organism information
 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 270/271 (99%), Positives = 270/271 (99%)

Query: 1   MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGD 60
           MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGD
Sbjct: 1   MSRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGD 60

Query: 61  FTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFL 120
           FTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFL
Sbjct: 61  FTKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFL 120

Query: 121 ANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVV 180
           ANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVV
Sbjct: 121 ANSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVV 180

Query: 181 HDVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIRE 240
           HDVIPYG LNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIRE
Sbjct: 181 HDVIPYGTLNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIRE 240

Query: 241 QNVSCPEVSDIINFIFADRKRPLSNWGNSKK 271
           QNVSCPEVSDIINFIFADRKRPLSNWGNSKK
Sbjct: 241 QNVSCPEVSDIINFIFADRKRPLSNWGNSKK 271


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121986|ref|YP_004062475.1| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 268 Back     alignment and organism information
>gi|227821907|ref|YP_002825877.1| UDP-N-acetylglucosamine acyltransferase [Sinorhizobium fredii NGR234] Length = 270 Back     alignment and organism information
>gi|190891617|ref|YP_001978159.1| lipid A biosynthesis acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamin e O-acyltransferase [Rhizobium etli CIAT 652] Length = 272 Back     alignment and organism information
>gi|327189232|gb|EGE56411.1| lipid A biosynthesis acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamin e O-acyltransferase protein [Rhizobium etli CNPAF512] Length = 272 Back     alignment and organism information
>gi|241204514|ref|YP_002975610.1| UDP-N-acetylglucosamine acyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 272 Back     alignment and organism information
>gi|209549192|ref|YP_002281109.1| UDP-N-acetylglucosamine acyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 272 Back     alignment and organism information
>gi|86357544|ref|YP_469436.1| UDP-N-acetylglucosamine acyltransferase [Rhizobium etli CFN 42] Length = 272 Back     alignment and organism information
>gi|116251987|ref|YP_767825.1| UDP-N-acetylglucosamine acyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 272 Back     alignment and organism information
>gi|222085867|ref|YP_002544398.1| acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine O-acyltransferase [Agrobacterium radiobacter K84] Length = 271 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target271 UDP-N-acetylglucosamine acyltransferase [Candidatus Lib
PRK05289262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransfe 1e-101
TIGR01852254 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--U 1e-87
COG1043260 COG1043, LpxA, Acyl-[acyl carrier protein] 8e-86
PRK12461255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransfe 2e-64
cd03351254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-a 2e-93
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltrans 1e-23
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 3e-23
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] g 3e-20
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamin 2e-19
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phos 1e-06
PRK14357448 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phos 1e-04
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltr 0.001
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate u 0.001
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 4e-14
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 9e-12
cd04650154 cd04650, LbH_FBP, Ferripyochelin Binding Protein (FBP): 1e-06
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch supe 6e-05
TIGR03532231 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dica 4e-04
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)- 0.001
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 2e-10
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 2e-10
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophospho 3e-06
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parall 7e-05
TIGR03532231 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dica 0.004
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltr 2e-08
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylas 6e-07
COG2171271 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransfe 8e-06
PRK14353446 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phos 2e-05
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phos 2e-05
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate u 4e-05
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophospho 1e-04
KOG1461 673 KOG1461, KOG1461, KOG1461, Translation initiation facto 2e-04
PRK14358481 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phos 6e-04
KOG1460407 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylas 8e-04
KOG1322371 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylas 4e-07
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 0.002
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix (Lbeta 0.002
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 0.003
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 5e-06
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-li 3e-04
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parall 4e-04
>gnl|CDD|179994 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130911 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>gnl|CDD|31245 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|162561 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|172831 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184644 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|100055 cd04650, LbH_FBP, Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>gnl|CDD|30459 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|172834 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|36673 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36536 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 271 UDP-N-acetylglucosamine acyltransferase [Candidatus Lib
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 100.0
COG1043260 LpxA Acyl-[acyl carrier protein] 100.0
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 100.0
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 100.0
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 100.0
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 100.0
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 100.0
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.86
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 100.0
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 100.0
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 100.0
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 100.0
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 100.0
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 99.97
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.97
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.97
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.96
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.96
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.95
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.92
PRK13627196 carnitine operon protein CaiE; Provisional 99.92
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.91
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.91
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.91
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.91
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.9
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.9
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.9
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.89
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.85
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.83
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.82
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.82
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.82
COG1043260 LpxA Acyl-[acyl carrier protein] 99.81
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.81
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.77
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.76
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.72
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.56
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.42
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.11
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 98.94
PRK10092183 maltose O-acetyltransferase; Provisional 98.91
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 98.73
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.25
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.95
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.95
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.88
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 99.7
KOG4750269 consensus 99.68
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.92
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.9
TIGR02353719 NRPS_term_dom non-ribosomal peptide synthetase terminal 98.68
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.9
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 99.8
PRK13627196 carnitine operon protein CaiE; Provisional 99.7
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.13
KOG4042190 consensus 98.98
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.88
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.86
KOG3121184 consensus 98.95
KOG3121184 consensus 97.56
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 99.85
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 99.82
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.81
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 99.78
PRK10092183 maltose O-acetyltransferase; Provisional 99.75
PRK11132273 cysE serine acetyltransferase; Provisional 99.63
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 99.62
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 99.61
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 99.57
PRK03282406 consensus 98.76
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.81
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.77
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.11
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 99.05
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 98.98
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 98.97
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.88
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.74
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 98.7
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 98.69
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 98.68
PRK03282406 consensus 98.42
PRK01884435 consensus 98.31
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 98.23
PRK11132273 cysE serine acetyltransferase; Provisional 98.2
PRK01884435 consensus 98.04
KOG1462433 consensus 97.85
PRK03701431 consensus 97.8
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 97.76
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.8
KOG1461 673 consensus 99.22
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.71
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.72
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.32
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.27
PRK04928405 consensus 98.64
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 98.41
PRK03701431 consensus 98.39
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 98.29
PRK04928405 consensus 98.26
KOG1462433 consensus 98.2
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 97.9
COG4801277 Predicted acyltransferase [General function prediction 97.23
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 96.89
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 96.67
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.67
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 98.88
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 98.8
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.21
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.42
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.41
KOG1461 673 consensus 99.05
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 97.72
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.36
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 99.27
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.24
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 99.08
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.07
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 99.05
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.01
KOG1460407 consensus 98.94
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 98.9
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 98.83
TIGR02353 719 NRPS_term_dom non-ribosomal peptide synthetase terminal 98.76
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 98.71
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.66
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.54
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.52
KOG1460407 consensus 98.34
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.31
KOG1322371 consensus 98.26
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 97.71
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.18
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.61
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 97.42
COG4801277 Predicted acyltransferase [General function prediction 97.36
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 96.82
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 96.28
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.04
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 98.69
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 98.6
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 97.58
KOG4042190 consensus 98.95
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 96.82
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 98.93
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 98.54
KOG4750269 consensus 97.84
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.44
KOG1322371 consensus 98.05
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 94.97
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target271 UDP-N-acetylglucosamine acyltransferase [Candidatus Lib
2jf2_A264 Nucleotide Substrate Binding By Udp-N-Acetylglucosa 2e-38
2aq9_A262 Structure Of E. Coli Lpxa With A Bound Peptide That 6e-38
1j2z_A270 Crystal Structure Of Udp-N-Acetylglucosamine Acyltr 3e-28
3hsq_A259 Structural Basis For The Sugar Nucleotide And Acyl 7e-28
3r0s_A266 Udp-N-Acetylglucosamine Acyltransferase From Campyl 1e-24
3eh0_A341 Crystal Structure Of Lpxd From Escherichia Coli Len 6e-13
3eh0_A341 Crystal Structure Of Lpxd From Escherichia Coli Len 6e-12
2iu8_A374 Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Com 1e-10
2iu8_A374 Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Com 3e-05
3mqg_A192 Crystal Structure Of The 3-N-Acetyl Transferase Wlb 3e-09
3mqg_A192 Crystal Structure Of The 3-N-Acetyl Transferase Wlb 1e-06
3r8y_A240 Structure Of The Bacillus Anthracis Tetrahydropicol 2e-07
3r8y_A240 Structure Of The Bacillus Anthracis Tetrahydropicol 2e-05
2ic7_A185 Crystal Structure Of Maltose Transacetylase From Ge 2e-06
2v0h_A456 Characterization Of Substrate Binding And Catalysis 2e-06
1hv9_A456 Structure Of E. Coli Glmu: Analysis Of Pyrophosphor 4e-06
1fwy_A331 Crystal Structure Of N-Acetylglucosamine 1-Phosphat 4e-06
1ocx_A182 E. Coli Maltose-O-Acetyltransferase Length = 182 2e-05
3cj8_A236 Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- 4e-05
3cj8_A236 Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- 8e-04
3cj8_A236 Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- 0.002
3fs8_A273 Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Did 8e-05
3fs8_A273 Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Did 6e-04
2npo_A207 Crystal Structure Of Putative Transferase From Camp 1e-04
3hjj_A190 Crystal Structure Of Maltose O-Acetyltransferase Fr 1e-04
3fww_A456 The Crystal Structure Of The Bifunctional N-Acetylg 1e-04
3fww_A456 The Crystal Structure Of The Bifunctional N-Acetylg 0.002
3bss_A198 Pgld From Campylobacter Jejuni, Nctc 11168, With Na 1e-04
3bfp_A194 Crystal Structure Of Apo-Pgld From Campylobacter Je 1e-04
1v3w_A173 Structure Of Ferripyochelin Binding Protein From Py 3e-04
3r3r_A187 Structure Of The Yrda Ferripyochelin Binding Protei 5e-04
1hm9_A468 Crystal Structure Of S.Pneumoniae N-Acetylglucosami 8e-04
1g95_A459 Crystal Structure Of S.Pneumoniae Glmu, Apo Form Le 8e-04
1kqa_A203 Galactoside Acetyltransferase In Complex With Coenz 3e-04
>gi|146386897|pdb|2JF2|A Chain A, Nucleotide Substrate Binding By Udp-N-Acetylglucosamine Acyltransferase Length = 264 Back     alignment and structure
 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 114/262 (43%), Positives = 155/262 (59%)

Query: 2   SRMGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDF 61
           S +  +  +HP A+VEEGA IG N+ IGPFC VG  VEIG G  L SH VV G TKIG  
Sbjct: 2   SMIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRD 61

Query: 62  TKVFPMAVLGGDTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLA 121
            +++  A +G   Q   +    T + +G +  IRE VTI+RGTV+ GG T VG +N  + 
Sbjct: 62  NEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMI 121

Query: 122 NSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVH 181
           N+H+AHDC +GN  +L+NN  +AGHV VDD  + GG +AVHQF  IG +  +GG +GV  
Sbjct: 122 NAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQ 181

Query: 182 DVIPYGILNGNPGALRGVNVVAMRRAGFSRDTIHLIRAVYKQIFQQGDSIYKNAGAIREQ 241
           DV PY I  GN     GVN+  ++R GFSR+ I  IR  YK I++ G ++ +    I E 
Sbjct: 182 DVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAEL 241

Query: 242 NVSCPEVSDIINFIFADRKRPL 263
             + PEV    +F     +  +
Sbjct: 242 AETYPEVKAFTDFFARSTRGLI 263


gi|110590827|pdb|2AQ9|A Chain A, Structure Of E. Coli Lpxa With A Bound Peptide That Is Competitive With Acyl-Acp Length = 262 Back     alignment and structure
gi|42543005|pdb|1J2Z|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine Acyltransferase Length = 270 Back     alignment and structure
gi|257097287|pdb|3HSQ|A Chain A, Structural Basis For The Sugar Nucleotide And Acyl Chain Selectivity Of Leptospira Interrogans Lpxa Length = 259 Back     alignment and structure
>gi|326634628|pdb|3R0S|A Chain A, Udp-N-Acetylglucosamine Acyltransferase From Campylobacter Jejuni Length = 266 Back     alignment and structure
>gi|256032569|pdb|3EH0|A Chain A, Crystal Structure Of Lpxd From Escherichia Coli Length = 341 Back     alignment and structure
>gi|256032569|pdb|3EH0|A Chain A, Crystal Structure Of Lpxd From Escherichia Coli Length = 341 Back     alignment and structure
>gi|134104594|pdb|2IU8|A Chain A, Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Complex I) Length = 374 Back     alignment and structure
>gi|134104594|pdb|2IU8|A Chain A, Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Complex I) Length = 374 Back     alignment and structure
>gi|295982582|pdb|3MQG|A Chain A, Crystal Structure Of The 3-N-Acetyl Transferase Wlbb From Bo Petrii In Complex With Acetyl-Coa Length = 192 Back     alignment and structure
>gi|295982582|pdb|3MQG|A Chain A, Crystal Structure Of The 3-N-Acetyl Transferase Wlbb From Bo Petrii In Complex With Acetyl-Coa Length = 192 Back     alignment and structure
gi|329666277|pdb|3R8Y|A Chain A, Structure Of The Bacillus Anthracis Tetrahydropicolinate Succinyltransferase Length = 240 Back     alignment and structure
gi|329666277|pdb|3R8Y|A Chain A, Structure Of The Bacillus Anthracis Tetrahydropicolinate Succinyltransferase Length = 240 Back     alignment and structure
gi|119390088|pdb|2IC7|A Chain A, Crystal Structure Of Maltose Transacetylase From Geobacillus Kaustophilus Length = 185 Back     alignment and structure
gi|165761161|pdb|2V0H|A Chain A, Characterization Of Substrate Binding And Catalysis Of The Potential Antibacterial Target N-Acetylglucosamine-1- Phosphate Uridyltransferase (Glmu) Length = 456 Back     alignment and structure
gi|13399862|pdb|1HV9|A Chain A, Structure Of E. Coli Glmu: Analysis Of Pyrophosphorylase And Acetyltransferase Active Sites Length = 456 Back     alignment and structure
>gi|11514554|pdb|1FWY|A Chain A, Crystal Structure Of N-Acetylglucosamine 1-Phosphate Uridyltransferase Bound To Udp-Glcnac Length = 331 Back     alignment and structure
>gi|33357657|pdb|1OCX|A Chain A, E. Coli Maltose-O-Acetyltransferase Length = 182 Back     alignment and structure
>gi|170785257|pdb|3CJ8|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Enterococcus Faecalis V583 Length = 236 Back     alignment and structure
>gi|170785257|pdb|3CJ8|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Enterococcus Faecalis V583 Length = 236 Back     alignment and structure
>gi|170785257|pdb|3CJ8|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Enterococcus Faecalis V583 Length = 236 Back     alignment and structure
>gi|223674077|pdb|3FS8|A Chain A, Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Dideoxy-D- Glucose N-Acetyl Transferase From Thermoanaerobacterium Thermosaccharolyticum In Complex With Acetyl-Coa Length = 273 Back     alignment and structure
>gi|223674077|pdb|3FS8|A Chain A, Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Dideoxy-D- Glucose N-Acetyl Transferase From Thermoanaerobacterium Thermosaccharolyticum In Complex With Acetyl-Coa Length = 273 Back     alignment and structure
>gi|119390560|pdb|2NPO|A Chain A, Crystal Structure Of Putative Transferase From Campylobacter Jejuni Subsp. Jejuni Nctc 11168 Length = 207 Back     alignment and structure
>gi|238828328|pdb|3HJJ|A Chain A, Crystal Structure Of Maltose O-Acetyltransferase From Bacillus Anthracis Length = 190 Back     alignment and structure
gi|225734164|pdb|3FWW|A Chain A, The Crystal Structure Of The Bifunctional N-Acetylglucosamine-1- Phosphate UridyltransferaseGLUCOSAMINE-1-Phosphate Acetyltransferase From Yersinia Pestis Co92 Length = 456 Back     alignment and structure
gi|225734164|pdb|3FWW|A Chain A, The Crystal Structure Of The Bifunctional N-Acetylglucosamine-1- Phosphate UridyltransferaseGLUCOSAMINE-1-Phosphate Acetyltransferase From Yersinia Pestis Co92 Length = 456 Back     alignment and structure
>gi|194368661|pdb|3BSS|A Chain A, Pgld From Campylobacter Jejuni, Nctc 11168, With Native Substrate Length = 198 Back     alignment and structure
>gi|166007338|pdb|3BFP|A Chain A, Crystal Structure Of Apo-Pgld From Campylobacter Jejuni Length = 194 Back     alignment and structure
gi|39655008|pdb|1V3W|A Chain A, Structure Of Ferripyochelin Binding Protein From Pyrococcus Horikoshii Ot3 Length = 173 Back     alignment and structure
>gi|327200747|pdb|3R3R|A Chain A, Structure Of The Yrda Ferripyochelin Binding Protein From Salmonella Enterica Length = 187 Back     alignment and structure
>gi|17942977|pdb|1HM9|A Chain A, Crystal Structure Of S.Pneumoniae N-Acetylglucosamine-1- Phosphate Uridyltransferase, Glmu, Bound To Acetyl Coenzyme A And Udp-N-Acetylglucosamine Length = 468 Back     alignment and structure