254780770

254780770

(3R)-hydroxymyristoyl-ACP dehydratase

GeneID in NCBI database:8209776Locus tag:CLIBASIA_03305
Protein GI in NCBI database:254780770Protein Accession:YP_003065183.1
Gene range:+(492845, 493330)Protein Length:161aa
Gene description:(3R)-hydroxymyristoyl-ACP dehydratase
COG prediction:[I] 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases
KEGG prediction:fabZ; (3R)-hydroxymyristoyl-ACP dehydratase (EC:4.2.1.-); K02372 3R-hydroxymyristoyl ACP dehydrase [EC:4.2.1.-]
SEED prediction:(3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase (EC 4.2.1.-)
Pathway involved in KEGG:Fatty acid biosynthesis [PATH:las00061]
Subsystem involved in SEED:Fatty Acid Biosynthesis FASII
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
ccccccccccccHHHHHHHcccccccEEEEEEEEEEcccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEccEEEEEEEccccEEEEEEEEEEccccEEEEEEEEEEccEEEEEEEEEEEEEccHHHHHHccc
cccccccccHccHHHHHHHccccccEEEEEEEEEEccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHEcccccccccEEEEEEEcccccccccccccEEEEEEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEEEccHcccccccc
misdlacldaKDIVELMRflphrypfllvDKVVNiqrdesaigiknvtfnephfmghfpgrpvmpgVLILEGMAQTAGAICAIhngfdqyappylmsidkarfrkpvfpgdrleyHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKkekneshg
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVmhekkekneshg
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
******C**AKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEIC***************
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHE*********
*****ACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEK********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
254780460172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata 0.003
>gi|254780460|ref|YP_003064873.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 172 Back     alignment
 Score = 33.1 bits (74), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 43/102 (42%), Gaps = 7/102 (6%)

Query: 46  NVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRK 105
           ++T N   F  HF   PVMPG L L+ + Q  G          +      +S+   +FR 
Sbjct: 60  DITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGW---LGELGKGRAVSVSNIKFRG 116

Query: 106 PVFPGDRL-EYHVN---KVRNRVDLWKFQCCAKVENTVVAEA 143
            V P  +L EY ++    +R RV L       KV    + +A
Sbjct: 117 MVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQA 158

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
140063965161 3-hydroxymyristoyl/3-hydroxyldecanoyl-[acyl carrier pro 1 6e-91
315121987160 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber 1 7e-70
307942152161 beta-hydroxyacyl-(acyl-carrier-protein) dehydratase Fab 1 2e-49
222085866157 beta-hydroxyacyl-(acyl-carrier-protein) dehydratase Fab 1 2e-48
328543721154 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratas 1 3e-48
163760892157 (3R)-hydroxymyristoyl ACP dehydratase [Hoeflea phototro 1 4e-48
114704866156 (3R)-hydroxymyristoyl ACP dehydratase [Fulvimarina pela 1 6e-48
90419601150 3-hydroxymyristoyl/3-hydroxyldecanoyl-[acyl carrier pro 1 9e-48
325292746155 3R-hydroxymyristoyl-ACP dehydratase [Agrobacterium sp. 1 2e-47
227821906154 (3R)-hydroxymyristoyl-ACP dehydratase [Sinorhizobium fr 1 2e-47
>gi|140063965|gb|ABO82469.1| 3-hydroxymyristoyl/3-hydroxyldecanoyl-[acyl carrier protein] dehydratase [Candidatus Liberibacter asiaticus] Length = 161 Back     alignment and organism information
 Score =  336 bits (862), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 160/161 (99%), Positives = 161/161 (100%)

Query: 1   MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60
           MISDLACLDAKDIVELM+FLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG
Sbjct: 1   MISDLACLDAKDIVELMQFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60

Query: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120
           RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV
Sbjct: 61  RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120

Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161
           RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
Sbjct: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121987|ref|YP_004062476.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 160 Back     alignment and organism information
>gi|307942152|ref|ZP_07657503.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Roseibium sp. TrichSKD4] Length = 161 Back     alignment and organism information
>gi|222085866|ref|YP_002544397.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ [Agrobacterium radiobacter K84] Length = 157 Back     alignment and organism information
>gi|328543721|ref|YP_004303830.1| (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase [polymorphum gilvum SL003B-26A1] Length = 154 Back     alignment and organism information
>gi|163760892|ref|ZP_02167971.1| (3R)-hydroxymyristoyl ACP dehydratase [Hoeflea phototrophica DFL-43] Length = 157 Back     alignment and organism information
>gi|114704866|ref|ZP_01437774.1| (3R)-hydroxymyristoyl ACP dehydratase [Fulvimarina pelagi HTCC2506] Length = 156 Back     alignment and organism information
>gi|90419601|ref|ZP_01227511.1| 3-hydroxymyristoyl/3-hydroxyldecanoyl-[acyl carrier protein] dehydratase [Aurantimonas manganoxydans SI85-9A1] Length = 150 Back     alignment and organism information
>gi|325292746|ref|YP_004278610.1| 3R-hydroxymyristoyl-ACP dehydratase [Agrobacterium sp. H13-3] Length = 155 Back     alignment and organism information
>gi|227821906|ref|YP_002825876.1| (3R)-hydroxymyristoyl-ACP dehydratase [Sinorhizobium fredii NGR234] Length = 154 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
PRK00006147 PRK00006, fabZ, (3R)-hydroxymyristoyl-ACP dehydratase; 5e-61
TIGR01750140 TIGR01750, fabZ, beta-hydroxyacyl-[acyl carrier protein 2e-50
PRK13188464 PRK13188, PRK13188, bifunctional UDP-3-O-[3-hydroxymyri 1e-42
COG0764147 COG0764, FabA, 3-hydroxymyristoyl/3-hydroxydecanoyl-(ac 3e-39
cd00493131 cd00493, FabA_FabZ, FabA/Z, beta-hydroxyacyl-acyl carri 1e-37
pfam07977133 pfam07977, FabA, FabA-like domain 7e-33
cd01287150 cd01287, FabA, FabA, beta-hydroxydecanoyl-acyl carrier 1e-06
cd01289138 cd01289, FabA_like, Domain of unknown function, appears 4e-05
cd01288131 cd01288, FabZ, FabZ is a 17kD beta-hydroxyacyl-acyl car 5e-45
cd03440100 cd03440, hot_dog, The hotdog fold was initially identif 1e-05
cd03448122 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot dog 3e-04
cd03441127 cd03441, R_hydratase_like, (R)-hydratase [(R)-specific 0.004
PRK05174172 PRK05174, PRK05174, 3-hydroxydecanoyl-(acyl carrier pro 9e-04
>gnl|CDD|178788 PRK00006, fabZ, (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|130811 TIGR01750, fabZ, beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>gnl|CDD|183883 PRK13188, PRK13188, bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|31107 COG0764, FabA, 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|48029 cd00493, FabA_FabZ, FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>gnl|CDD|149192 pfam07977, FabA, FabA-like domain Back     alignment and domain information
>gnl|CDD|48032 cd01287, FabA, FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>gnl|CDD|48034 cd01289, FabA_like, Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>gnl|CDD|48033 cd01288, FabZ, FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>gnl|CDD|48035 cd03440, hot_dog, The hotdog fold was initially identified in the E Back     alignment and domain information
>gnl|CDD|48043 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>gnl|CDD|48036 cd03441, R_hydratase_like, (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>gnl|CDD|179953 PRK05174, PRK05174, 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
TIGR01750142 fabZ beta-hydroxyacyl-(acyl-carrier-protein) dehydratas 100.0
PRK13188465 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylgluco 100.0
PRK00006149 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed 100.0
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier prote 100.0
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier 100.0
pfam07977133 FabA FabA-like domain. This enzyme domain has a HotDog 100.0
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein 100.0
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (A 99.96
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; V 99.94
cd01289138 FabA_like Domain of unknown function, appears to be rel 99.89
TIGR01749169 fabA beta-hydroxyacyl-(acyl-carrier-protein) dehydratas 99.7
COG4706161 Predicted 3-hydroxylacyl-(acyl carrier protein) dehydra 99.49
PRK04424185 fatty acid biosynthesis transcriptional regulator; Prov 98.91
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC ( 98.36
PRK08190 465 bifunctional enoyl-CoA hydratase/phosphate acetyltransf 98.09
PRK11563676 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase 97.44
COG2050141 PaaI HGG motif-containing thioesterase, possibly involv 97.33
KOG3328148 consensus 96.81
TIGR02286115 PaaD phenylacetic acid degradation protein PaaD; InterP 96.68
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameric acy 96.61
PRK11688154 hypothetical protein; Provisional 94.66
TIGR02278690 PaaN-DH phenylacetic acid degradation protein paaN; Int 94.32
PRK10254137 hypothetical protein; Provisional 94.12
PRK10293136 hypothetical protein; Provisional 91.96
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein wit 98.37
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine oxid 98.34
cd03440100 hot_dog The hotdog fold was initially identified in the 98.21
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydra 98.01
PRK10694133 acyl-CoA thioester hydrolase; Provisional 97.79
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fa 97.77
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA 97.76
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). Brai 97.46
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to the S 97.45
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of th 97.29
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 96.93
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis protein w 96.88
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisio 96.69
COG5496130 Predicted thioesterase [General function prediction onl 96.1
cd03450149 NodN NodN (nodulation factor N) contains a single hot d 95.45
smart00826167 PKS_DH PKS_DH. 95.15
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is thoug 93.02
KOG3016 294 consensus 90.26
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belongs t 98.18
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 97.25
COG0824137 FcbC Predicted thioesterase [General function predictio 96.92
PRK10800130 acyl-CoA thioester hydrolase YbgC; Provisional 96.8
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyze 96.57
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisio 96.34
pfam0306179 4HBT Thioesterase superfamily. This family contains a w 96.2
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisio 95.39
TIGR02799127 thio_ybgC tol-pal system-associated acyl-CoA thioestera 94.62
PRK10526 286 acyl-CoA thioesterase II; Provisional 94.51
COG1946289 TesB Acyl-CoA thioesterase [Lipid metabolism] 92.68
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought to re 92.22
TIGR00051121 TIGR00051 conserved hypothetical protein; InterPro: IPR 90.51
COG4109432 Predicted transcriptional regulator containing CBS doma 90.04
pfam01575123 MaoC_dehydratas MaoC like domain. The maoC gene is part 97.17
>TIGR01750 fabZ beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ; InterPro: IPR010084 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>pfam07977 FabA FabA-like domain Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA; InterPro: IPR010083 This enzyme, FabA, shows overlapping substrate specificity with FabZ with regard to chain length in fatty acid biosynthesis Back     alignment and domain information
>COG4706 Predicted 3-hydroxylacyl-(acyl carrier protein) dehydratase [Lipid metabolism] Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3328 consensus Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD; InterPro: IPR011973 This members of this family belong to the thioesterase superfamily IPR006683 from INTERPRO, and are nearly always found adjacent to other genes of the phenylacetic acid degradation pathway Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN; InterPro: IPR011966 This enzyme is proposed to act in the ring-opening step of phenylacetic acid degradation which follows ligation of the acid with coenzyme A (by PaaF) and hydroxylation by a multicomponent non-heme iron hydroxylase complex (PaaGHIJK) Back     alignment and domain information
>PRK10254 hypothetical protein; Provisional Back     alignment and domain information
>PRK10293 hypothetical protein; Provisional Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>PRK10694 acyl-CoA thioester hydrolase; Provisional Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>smart00826 PKS_DH PKS_DH Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>KOG3016 consensus Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK10800 acyl-CoA thioester hydrolase YbgC; Provisional Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>pfam03061 4HBT Thioesterase superfamily Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase; InterPro: IPR014166 The tol-pal system consists of five critical genes Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>TIGR00051 TIGR00051 conserved hypothetical protein; InterPro: IPR006684 4-hydroxybenzoyl-CoA thioesterase (3 Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>pfam01575 MaoC_dehydratas MaoC like domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
1u1z_A168 The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase ( 1e-35
3d6x_A146 Crystal Structure Of Campylobacter Jejuni Fabz Leng 3e-34
2gll_A171 Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier 2e-33
3b7j_A159 Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier 3e-33
2glv_A171 Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier 6e-33
1z6b_A154 Crystal Structure Of Plasmodium Falciparum Fabz At 7e-29
1zhg_A139 Crystal Structure Of Beta-Hydroxyacyl-Acyl Carrier 1e-26
2okh_A136 Crystal Structure Of Dimeric Form Of Pffabz In Crys 2e-25
3q62_A175 Crystal Structure Of 3-Hydroxydecanoyl-(Acyl Carrie 7e-10
2cf2_C 342 Architecture Of Mammalian Fatty Acid Synthase Lengt 9e-09
2cf2_C342 Architecture Of Mammalian Fatty Acid Synthase Lengt 9e-09
1mkb_A171 Escherichia Coli Beta-Hydroxydecanoyl Thiol Ester D 9e-09
>gi|55670131|pdb|1U1Z|A Chain A, The Structure Of (3r)-Hydroxyacyl-Acp Dehydratase (Fabz) Length = 168 Back     alignment and structure
 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 61/140 (43%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQ-RDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV +    +     KNV+ NEP F GHFP  P+ PGVLI+
Sbjct: 23  DINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIXPGVLII 82

Query: 71  EGMAQTAGAICAIHNGFDQY--APPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E  AQ AG +               Y +  DK RFR+PV PGD+L+ H   +  +  +WK
Sbjct: 83  EAXAQAAGILGFKXLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVKRSIWK 142

Query: 129 FQCCAKVENTVVAEAEICAM 148
           F C A V++  V  AEI   
Sbjct: 143 FDCHATVDDKPVCSAEIICA 162


>gi|229597707|pdb|3D6X|A Chain A, Crystal Structure Of Campylobacter Jejuni Fabz Length = 146 Back     alignment and structure
>gi|145579403|pdb|2GLL|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(Fabz) From Helicobacter Pylori Length = 171 Back     alignment and structure
>gi|197725029|pdb|3B7J|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(Fabz) From Helicobacter Pylori Complexed With Juglone Length = 159 Back     alignment and structure
>gi|145579421|pdb|2GLV|A Chain A, Crystal Structure Of (3r)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(Fabz) Mutant(Y100a) From Helicobacter Pylori Length = 171 Back     alignment and structure
>gi|71042184|pdb|1Z6B|A Chain A, Crystal Structure Of Plasmodium Falciparum Fabz At 2.1 A Length = 154 Back     alignment and structure
>gi|109156958|pdb|1ZHG|A Chain A, Crystal Structure Of Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (Fabz) From Plasmodium Falciparum Length = 139 Back     alignment and structure
>gi|146387615|pdb|2OKH|A Chain A, Crystal Structure Of Dimeric Form Of Pffabz In Crystal Form3 Length = 136 Back     alignment and structure
>gi|317455542|pdb|3Q62|A Chain A, Crystal Structure Of 3-Hydroxydecanoyl-(Acyl Carrier Protein) Dehydratase From Yersinia Pestis Length = 175 Back     alignment and structure
>gi|93279104|pdb|2CF2|C Chain C, Architecture Of Mammalian Fatty Acid Synthase Length = 342 Back     alignment and structure
>gi|93279104|pdb|2CF2|C Chain C, Architecture Of Mammalian Fatty Acid Synthase Length = 342 Back     alignment and structure
>gi|1633163|pdb|1MKB|A Chain A, Escherichia Coli Beta-Hydroxydecanoyl Thiol Ester Dehydrase At Ph 5 And 21 Degrees C Length = 171 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydr 4e-37
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratas 2e-34
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratas 7e-34
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, beta-hyd 3e-30
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty acid 8e-23
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty acid 3e-18
1mka_A171 Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid 2e-22
3esi_A129 Uncharacterized protein; protein from erwinia carotovor 4e-21
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Ph 2e-08
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG fold 2e-07
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG 2e-04
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural 3e-04
3khp_A311 MAOC family protein; ssgcid, NIH, niaid, decode, univer 0.001
1q6w_A161 Monoamine oxidase regulatory protein, putative; structu 0.001
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhy 0.001
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Length = 171 Back     alignment and structure
 Score =  148 bits (376), Expect = 4e-37
 Identities = 63/147 (42%), Positives = 92/147 (62%), Gaps = 5/147 (3%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71
            I  +++ LPHRYP LLVD++  +Q ++  +  KN+TFNE  F GHFP +P+ PGVLI+E
Sbjct: 25  FIEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVE 84

Query: 72  GMAQTAGAICAIHNGFDQYAP-----PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDL 126
           GMAQ+ G +                  Y M+IDK +FR PV PGDRLEYH+  ++++  +
Sbjct: 85  GMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKGMI 144

Query: 127 WKFQCCAKVENTVVAEAEICAMVMHEK 153
           W+    A+V+  VVAEAE+ AM+   +
Sbjct: 145 WQVGGTAQVDGKVVAEAELKAMIAERE 171


>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Length = 168 Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, cytoplasm, lipid A biosynthesis, lipid synthesis; HET: MSE; 2.59A {Campylobacter jejuni subsp} Length = 146 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 1zhg_A 2oki_A 2okh_A Length = 154 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Length = 342 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Length = 342 Back     alignment and structure
>1mka_A Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid biosynthesis; HET: DAC; 2.00A {Escherichia coli} SCOP: d.38.1.2 PDB: 1mkb_A Length = 171 Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Length = 129 Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Length = 332 Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Length = 298 Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Length = 280 Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural genomics, structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Length = 148 Back     alignment and structure
>3khp_A MAOC family protein; ssgcid, NIH, niaid, decode, university of washington, emerald biostructures, SBRI, dehydrogenase; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Length = 311 Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus dsm 4304} SCOP: d.38.1.4 Length = 161 Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Length = 134 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratas 100.0
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydr 100.0
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, beta-hyd 100.0
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratas 100.0
1mka_A171 Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid 100.0
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty acid 100.0
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty acid 99.96
3esi_A129 Uncharacterized protein; protein from erwinia carotovor 99.92
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene regulat 99.37
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, 98.7
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA 98.62
1q6w_A161 Monoamine oxidase regulatory protein, putative; structu 98.53
2b3n_A159 Hypothetical protein AF1124; structural genomics, PSI, 98.38
2cwz_A141 Thioesterase family protein; structural genomics, NPPSF 98.38
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA 98.36
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagella, unkno 98.34
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics, unk 98.3
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hydrola 98.26
1wlu_A136 PAAI protein, phenylacetic acid degradation protein PAA 98.15
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, struct 98.13
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhy 98.11
2h4u_A145 Thioesterase superfamily member 2; structural genomics, 98.09
1zki_A133 Hypothetical protein PA5202; structural genomics, PSI, 97.97
1vh5_A148 Hypothetical protein YDII; PSI, protein structure initi 97.92
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, st 97.89
2qwz_A159 Phenylacetic acid degradation-related protein; putative 97.89
2pim_A141 Phenylacetic acid degradation-related protein; thioeste 97.74
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon, str 97.52
2hx5_A152 Hypothetical protein; NP_895880.1, structural genomics, 97.46
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arth 97.45
1vh9_A149 P15, hypothetical protein YBDB; structural genomics, un 97.45
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural genom 97.39
1o0i_A138 Hypothetical protein HI1161; structural genomics, PSI, 97.38
3nwz_A176 BH2602 protein; structural genomics, PSI-2, protein str 97.35
3hdu_A157 Putative thioesterase; YP_461911.1, structural genomics 97.34
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, stru 97.24
3e1e_A141 Thioesterase family protein; structural genomics, PSI-2 97.12
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, PF0306 96.93
3hrq_A357 PKS, aflatoxin biosynthesis polyketide synthase; hot-DO 96.83
3kg8_A308 CURJ; polyketide synthase, double hotdog fold, dehydrat 96.66
3kg7_A293 CURH; polyketide synthase, double hotdog fold, dehydrat 96.36
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG struc 96.27
3hrq_A 357 PKS, aflatoxin biosynthesis polyketide synthase; hot-DO 96.18
1t82_A155 Hypothetical acetyltransferase; structural genomics, al 96.08
1sh8_A154 Hypothetical protein PA5026; structural genomics, PSI, 94.23
3kg9_A296 CURK; polyketide synthase, double hotdog fold, dehydrat 94.19
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural 98.21
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetical, ho 98.03
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, str 98.02
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural proteomics 97.74
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, trime 97.73
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; alternat 97.71
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme A, pr 97.7
2eis_A133 Hypothetical protein TTHB207; COA binding motif, NPPSFA 97.67
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, 97.62
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, acyl-CO 97.58
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, structura 97.58
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structural g 97.58
2q78_A153 Uncharacterized protein; TM0581, structural genomics, j 97.58
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structural g 97.47
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C 97.47
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomics, j 97.39
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C 97.27
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Ph 97.27
3kg6_A 285 CURF; polyketide synthase, double hotdog fold, dehydrat 97.23
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, structura 97.21
3kg9_A 296 CURK; polyketide synthase, double hotdog fold, dehydrat 97.08
3cjy_A 259 Putative thioesterase; YP_496845.1, structural genomics 96.93
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG fold 96.91
2bi0_A337 Hypothetical protein RV0216; conserved hypothetical, ho 96.64
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG 96.55
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase, str 96.07
1tbu_A118 Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeas 96.04
1c8u_A 285 Acyl-COA thioesterase II; internal repeats, hydrolase; 95.79
2hbo_A158 Hypothetical protein (NP_422103.1); structural genomics 97.7
3gek_A146 Putative thioesterase YHDA; X-RAY, structure genomics, 97.5
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; structural 97.28
1z54_A132 Probable thioesterase; hypothetical protein, structural 97.17
2egj_A128 Hypothetical protein AQ_1494; structural genomics, NPPS 97.14
2gf6_A135 Conserved hypothetical protein; putative thioesterase, 97.09
2cye_A133 TTHA1846, putative thioesterase; structural genomics, N 97.03
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide biosynthe 97.03
2fuj_A137 Conserved hypothetical protein; structural genomics, X- 96.8
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enediyne b 96.74
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1.91A 96.69
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural genom 96.64
2ali_A158 Hypothetical protein PA2801; structural genomics, PSI, 96.6
1njk_A156 Hypothetical protein YBAW; structural genomics, thioest 96.58
2hlj_A157 Hypothetical protein; putative thioesterase, structural 96.54
1s5u_A138 Protein YBGC; structural genomics, hypothetical protein 96.44
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bacteria 96.4
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, cataly 96.25
3ck1_A150 Putative thioesterase; structural genomics, joint cente 96.12
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA08564, s 96.1
3bbj_A 272 Putative thioesterase II; structural genomics, joint ce 95.51
2own_A262 Putative oleoyl-[acyl-carrier protein] thioesterase; NP 94.88
1s9c_A 298 Peroxisomal multifunctional enzyme type 2; hot-DOG fold 94.62
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioesterase; NP 94.42
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural genomics 93.11
3el6_A 313 Erythromycin dehydratase; dehydratase double hotdog fol 96.73
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, cytoplasm, lipid A biosynthesis, lipid synthesis; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
Probab=100.00  E-value=1.4e-45  Score=292.77  Aligned_cols=142  Identities=46%  Similarity=0.842  Sum_probs=133.1

Q ss_pred             HHHHHHHHHCCCCCCEEEEEEEEEEECCCEEEEEEEECCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC---C
Q ss_conf             4189899847999750547899998469749999982688831313479995022566999986346345443299---7
Q gi|254780770|r   11 KDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNG---F   87 (161)
Q Consensus        11 ~~~~eI~~~lPhr~Pfl~ID~i~~~~~g~~~~g~k~v~~~e~ff~gHFp~~PvmPGvLliE~maQ~~~~l~~~~~~---~   87 (161)
                      +|++||+++||||+||||||||++++||++++|+|+|+.|+|||+||||++|+|||||++|+|||+++++++....   .
T Consensus         2 ~~~~~I~~llPhr~PfllvD~i~~~~~~~~i~~~k~v~~~~~ff~~hfp~~pv~Pgvl~iE~~aQ~~~~l~~~~~~~~~~   81 (146)
T 3d6x_A            2 IDVMQIQEILPHRYPFLLVDKITELKVKEVVLGYKNISISDHVFMGHFPGHPIYPGVLILEGMAQTGGVLAFESMEDKVD   81 (146)
T ss_dssp             BCHHHHHHHCCCCTTSCCCCEEEEEETTTEEEEEEECCTTBTHHHHSCTTSCCCCHHHHHHHHHHHHHHHHHTC------
T ss_pred             CCHHHHHHHCCCCCCEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             89799998679999948899999981898899999647886220687899998975489999999999998740344447


Q ss_pred             CCCEEEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEEEECC
Q ss_conf             76302677523641360022128889999999972077799999999999999989999998445
Q gi|254780770|r   88 DQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAMVMHE  152 (161)
Q Consensus        88 ~~~~~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v~~~~va~a~l~~~i~~~  152 (161)
                      ..+..++|.+++++||+++|.|||+|++++++.+.+++++.++|+++|||+++|+|+++++++++
T Consensus        82 ~~~~~~~l~~i~~~kf~~~v~PGd~l~i~~~~~~~~~~~~~~~~~~~v~~~~va~a~l~~~~~d~  146 (146)
T 3d6x_A           82 PKSKVVYFTGIDGAKFRNPVRPGDRLDYEMSVVKNRGNMWIFKGQAFVDGNLVAEAELKAMIVDK  146 (146)
T ss_dssp             -CCSCEEEEEEEEEEECSCCCTTCEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEEC--
T ss_pred             CCCCEEEEECCCEEEECCCCCCCEEEEEEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEEEECC
T ss_conf             77726998315369994555898199999999982189999999999999999999999999659



>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>1mka_A Beta-hydroxydecanoyl thiol ester dehydrase; fatty acid biosynthesis; HET: DAC; 2.00A {Escherichia coli} SCOP: d.38.1.2 PDB: 1mkb_A Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown function; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus dsm 4304} SCOP: d.38.1.4 Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Thermus thermophilus HB8} SCOP: d.38.1.7 Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagella, unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, structural genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural genomics, joint center for structural genomics, JCSG; 1.50A {Shewanella loihica pv-4} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Pseudomonas aeruginosa PAO1} SCOP: d.38.1.5 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2hx5_A Hypothetical protein; NP_895880.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.50A {Prochlorococcus marinus str} SCOP: d.38.1.1 Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, unknown function; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>3hdu_A Putative thioesterase; YP_461911.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella bronchiseptica} Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>3hrq_A PKS, aflatoxin biosynthesis polyketide synthase; hot-DOG fold, iterative type I PKS, norsolorinic acid, product template domain; HET: PLM; 1.80A {Aspergillus parasiticus} PDB: 3hrr_A* Back     alignment and structure
>3kg8_A CURJ; polyketide synthase, double hotdog fold, dehydratase, lyase; 2.45A {Lyngbya majuscula} Back     alignment and structure
>3kg7_A CURH; polyketide synthase, double hotdog fold, dehydratase, lyase; 2.77A {Lyngbya majuscula} Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3hrq_A PKS, aflatoxin biosynthesis polyketide synthase; hot-DOG fold, iterative type I PKS, norsolorinic acid, product template domain; HET: PLM; 1.80A {Aspergillus parasiticus} PDB: 3hrr_A* Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis mr-1} SCOP: d.38.1.5 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3kg9_A CURK; polyketide synthase, double hotdog fold, dehydratase, lyase; 1.70A {Lyngbya majuscula} Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structural genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural genomics, structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; alternative splicing, acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural genomics, MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein structural and functional analyses; HET: COA; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consortium, SGC, cytoplasm, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Agrobacterium tumefaciens str} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2q78_A Uncharacterized protein; TM0581, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint center for structural genomics, JCSG; 2.50A {Agrobacterium tumefaciens str} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: COA; 1.66A {Bacillus halodurans c-125} SCOP: d.38.1.1 Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>3kg6_A CURF; polyketide synthase, double hotdog fold, dehydratase, lyase; 2.70A {Lyngbya majuscula} Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consortium, SGC, cytoplasm, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>3kg9_A CURK; polyketide synthase, double hotdog fold, dehydratase, lyase; 1.70A {Lyngbya majuscula} Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); structural genomics, PSI- 2, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; X-RAY, structure genomics, NESG, KR113, Q9CHK5_lacla, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, PSI-2, protein structure initiative; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus HB8} SCOP: d.38.1.1 Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, X-RAY diffraction, hot DOG domain acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.00A {Pseudomonas putida KT2440} SCOP: d.38.1.1 Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioesterase, hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori 26695} Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha JMP134} Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca YX} Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioesterase; NP_784467.1, oleoyl thioesterase (putative), structural genomics; 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioesterase; NP_784467.1, oleoyl thioesterase (putative), structural genomics; 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>3el6_A Erythromycin dehydratase; dehydratase double hotdog fold CIS-proline, acyltransferase, antibiotic biosynthesis; 1.85A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
d1u1za_145 d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ 1e-33
d1z6ba1146 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase 3e-30
d1mkaa_171 d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase 1e-19
d2f41a1111 d.38.1.5 (A:73-183) Transcription factor FapR, C-termin 4e-13
d1s9ca1126 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of mu 5e-07
d2b3na1154 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeo 0.001
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Length = 145 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: FabZ-like
domain: (3R)-hydroxymyristoyl ACP dehydrase FabZ
species: Pseudomonas aeruginosa [TaxId: 287]
 Score =  135 bits (342), Expect = 1e-33
 Identities = 65/141 (46%), Positives = 84/141 (59%), Gaps = 4/141 (2%)

Query: 12  DIVELMRFLPHRYPFLLVDKVVNIQRD-ESAIGIKNVTFNEPHFMGHFPGRPVMPGVLIL 70
           DI E+  +LPHRYPFLLVD+VV +  + +     KNV+ NEP F GHFP  P+MPGVLI+
Sbjct: 3   DINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIMPGVLII 62

Query: 71  EGMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128
           E MAQ AG +               Y +  DK RFR+PV PGD+L+ H   +  +  +WK
Sbjct: 63  EAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVKRSIWK 122

Query: 129 FQCCAKVENTVVAEAEI-CAM 148
           F C A V++  V  AEI CA 
Sbjct: 123 FDCHATVDDKPVCSAEIICAE 143


>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 146 Back     information, alignment and structure
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 111 Back     information, alignment and structure
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target161 (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liber
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria paras 100.0
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas a 100.0
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escherichia 100.0
d2f41a1111 Transcription factor FapR, C-terminal domain {Bacillus 99.32
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus horiko 98.6
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [TaxId 98.25
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobus ful 98.17
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginosa [Ta 97.8
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional peroxis 97.75
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId: 562 97.7
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenzae [Ta 97.69
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermus the 97.67
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., st 97.58
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escherichia 97.49
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId: 562 97.39
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional peroxis 96.58
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensis [Ta 95.4
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginosa [Ta 92.15
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginosa [Ta 90.87
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Archaeog 98.61
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilus [Ta 98.52
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium tuber 98.19
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae [Tax 98.03
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritima [Ta 97.95
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tuberculosis 97.78
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium t 97.75
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium t 97.7
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396 97.52
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haemophil 97.47
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium tuber 97.47
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 97.43
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional peroxis 97.22
d1c8ua1114 Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} 96.56
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {B 96.28
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus 96.07
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentus [Ta 97.92
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus marinus [ 97.53
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [TaxId: 97.43
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [Tax 97.39
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophilus [T 97.21
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophilus [T 97.01
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestris pv 96.95
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId: 562 96.81
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId: 562 96.78
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus solfa 96.76
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [Ta 96.58
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeruginos 96.49
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus 96.49
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 96.47
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginosa [Ta 96.29
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [Ta 96.19
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional peroxis 96.14
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS 96.07
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 92.85
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [Ta 92.25
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: FabZ-like
domain: (3R)-hydroxymyristoyl ACP dehydrase FabZ
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]
Probab=100.00  E-value=1.4e-45  Score=292.00  Aligned_cols=142  Identities=38%  Similarity=0.683  Sum_probs=131.7

Q ss_pred             CHHHHHHHHHHCCCCCCEEEEEEEEEEECCCEEEEEEEECCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             86418989984799975054789999846974999998268883131347999502256699998634634544329977
Q gi|254780770|r    9 DAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFD   88 (161)
Q Consensus         9 ~~~~~~eI~~~lPhr~Pfl~ID~i~~~~~g~~~~g~k~v~~~e~ff~gHFp~~PvmPGvLliE~maQ~~~~l~~~~~~~~   88 (161)
                      +.+|++||+++||||+||||||||++++||++++|+|+|+.|||||+||||++|+|||||++|+|||+++++.....+..
T Consensus         2 ~~~~~~~I~~llPhr~Pfl~vD~i~~~~~g~~~~~~k~v~~~e~~f~ghfp~~Pi~PgvlliEa~aQ~~~~l~~~~~~~~   81 (146)
T d1z6ba1           2 TSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGLKQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDDSQ   81 (146)
T ss_dssp             CCBCHHHHHHHCCCCTTSCCCCEEEEEETTTEEEEEEECCTTSGGGGTSCTTSCCCCHHHHHHHHHHHHHHHHHHHC---
T ss_pred             CCCCHHHHHHHCCCCCCEEEEEEEEEEECCCEEEEEEECCCCCCEEECCCCCCCCEEHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             83499999976789888267899999957955999998377752511205885402017899999999889987354334


Q ss_pred             CCEEEEEEECCCCEEEEEEEECCEEEEEEEEEEEEC--CEEEEEEEEEECCEEEEEE-EEEEEEE
Q ss_conf             630267752364136002212888999999997207--7799999999999999989-9999984
Q gi|254780770|r   89 QYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV--DLWKFQCCAKVENTVVAEA-EICAMVM  150 (161)
Q Consensus        89 ~~~~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~--~~~~~~~~~~v~~~~va~a-~l~~~i~  150 (161)
                      +++.++|++++++||+++|.|||+|++++++.+.++  ++++++|+++|||+++|++ ++++++.
T Consensus        82 ~~~~~~l~~i~~~kf~~~v~PGd~l~i~~~i~~~~~~~~i~~~~~~a~v~g~~v~~~~el~f~i~  146 (146)
T d1z6ba1          82 KNNLFLFAGVDGVRWKKPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALS  146 (146)
T ss_dssp             -CCCEEEEEEEEEEECSCCCTTCEEEEEEEEEEEETTTTEEEEEEEEEETTEEEEEEEEEEEEEC
T ss_pred             CCEEEEEEEECCCEEECEEECCCEEEEEEEEEEEECCCCEEEEEEEEEECCEEEEEEEEEEEEEC
T ss_conf             68079999810048923275287999999999981676399999999999999999450599939