254780771

254780771

UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase

GeneID in NCBI database:8209777Locus tag:CLIBASIA_03310
Protein GI in NCBI database:254780771Protein Accession:YP_003065184.1
Gene range:+(491800, 492843)Protein Length:347aa
Gene description:UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
COG prediction:none
KEGG prediction:lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC:2.3.1.-); K02536 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.-]
SEED prediction:UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.-)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
ccccHHEEccccccHHHHHHHHccEEEccccccEEEEccccccccccccEEEEEccccHHHHHHcccEEEEEcHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHccccccccccccccccEEccccEEccccEEccccEEccccEEccccEEccccEEccccEEccccEEccccEEEEEEEEEEEEEccccccccccccccccccccccEEccccEEEcccEEEccccEEEEcccccccccccEEEcccEEcccccEEccccEEccccccccccEEcccEEEccccEEEccEEEccccEEccccEEccccccccEEEEcccEEEcccEEEEEEcccHHHHHHcc
ccccccccccccccHHHHHHHHccEEcccccccEEEEccccHHHcccccccccccHHHHHHHHHccccEEEEcHHHHHHcccccEEEEEccHHHHHHHHHHHccccccccHHHHHcccccccEEEccccEEcccEEEcccEEEcccEEEcccEEEcccEEEcccEEEccccEEcccEEEEEEEEcccEEEEcccEEcccccccccccccEEEEcccEEEEEcccEEEccccEEccccccccEEcccEEEccEEEEEEEEEEcccEEEHHHccccccEEEccccEEccccEEccccEEccccEEccccEEcccEcccEEEEEccEEEEEEHHHHHHHHHHHHHHHccc
MQRLNFFVSHKGIALMKLAQSIGAslldenfgermiyslspiarastgdISYIISRKFLNNIEKCKASAiicsqdivpfipknipcllsdkpevsFAIAGSilypqamhmeassfeggispqaflgedvkiedgvviapmavvypgveigrktyvgpgsvigagvrigrncsigagssiyssLIGNSVILHSgvrigndgfgyargvsdihKIVHIGRVIIQdkveigansaidrgtiddtiigentkidnqvqighnvhIGCGCIIVSqvgiagstyigdnvliggqcgiagylkigdnvqiasksgvlkdipagqqyggmparpiGEYLRHMVmlskpskykikr
MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLspiarastGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIqdkveigansaidrgtiddtiigENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHmvmlskpskykikr
MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAidrgtiddtiigENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
***LNF*VSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQA***********I**QAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK*****
MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
****NFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target347 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer
255764481271 UDP-N-acetylglucosamine acyltransferase [Candidatu 2e-09
254780942442 UDP-N-acetylglucosamine pyrophosphorylase protein 8e-06
>gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 12/186 (6%)

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGV 194
           +I P+A+V  G  IG  + +GP   +G+ V IG    + +   +   + IG+   +    
Sbjct: 9   IIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMA 68

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID---DTIIGENTKIDN 251
            +G D        S  H  V    +++  K  I     I+RGT++    TI+G+N     
Sbjct: 69  VLGGDT------QSKYHNFVGT-ELLVGKKCVIREGVTINRGTVEYGGKTIVGDNNFFLA 121

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
              + H+  +G G ++ + V IAG   + D V+ GG   +  + +IG    I   +GV+ 
Sbjct: 122 NSHVAHDCKLGNGIVLSNNVMIAGHVIVDDRVVFGGGSAVHQFTRIGKYAFIGGMTGVVH 181

Query: 312 D-IPAG 316
           D IP G
Sbjct: 182 DVIPYG 187

>gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 442 Back     alignment
 Score = 42.7 bits (99), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 81/224 (36%), Gaps = 66/224 (29%)

Query: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151
           PE  F    +I+ P  +          I P  F G  V IE+ V I   + +  GV IG+
Sbjct: 259 PETVFLSHDTIIQPDTV----------IEPHVFFGCGVSIENYVQIRAFSYL-EGVHIGK 307

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           KT +GP + I     I +N  IG    +  + I                       S I+
Sbjct: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG--------------------SKIN 347

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
            + ++G                      D+++G+            NV+IG G I  +  
Sbjct: 348 HLSYVG----------------------DSVVGK------------NVNIGAGTITCNYD 373

Query: 272 GIAG-STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           G     T+I +N  IG    +   + IG    +AS S + +D P
Sbjct: 374 GTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTP 417

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target347 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer
140063966347 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 0.0
315121988339 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 1e-149
55380592271 putative UDP-3-O-3-hydroxymyristoyl glucosamine N-acylt 1 1e-148
209916652206 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 1e-112
222085865355 UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransfer 1 2e-99
86357542354 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 5e-99
209549190354 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 9e-99
222148854355 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 3e-98
190891615355 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 6e-98
327189230355 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer 1 1e-97
>gi|140063966|gb|ABO82470.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase protein [Candidatus Liberibacter asiaticus] Length = 347 Back     alignment and organism information
 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/347 (99%), Positives = 346/347 (99%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN
Sbjct: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS
Sbjct: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY
Sbjct: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
           SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT+ D
Sbjct: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTMGD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN
Sbjct: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
Sbjct: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121988|ref|YP_004062477.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 339 Back     alignment and organism information
>gi|55380592|gb|AAV50035.1| putative UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus] Length = 271 Back     alignment and organism information
>gi|209916652|gb|ACI96018.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus] Length = 206 Back     alignment and organism information
>gi|222085865|ref|YP_002544396.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Agrobacterium radiobacter K84] Length = 355 Back     alignment and organism information
>gi|86357542|ref|YP_469434.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Rhizobium etli CFN 42] Length = 354 Back     alignment and organism information
>gi|209549190|ref|YP_002281107.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 354 Back     alignment and organism information
>gi|222148854|ref|YP_002549811.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Agrobacterium vitis S4] Length = 355 Back     alignment and organism information
>gi|190891615|ref|YP_001978157.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Rhizobium etli CIAT 652] Length = 355 Back     alignment and organism information
>gi|327189230|gb|EGE56409.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase protein [Rhizobium etli CNPAF512] Length = 355 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target347 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamin 1e-112
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] g 2e-91
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 1e-82
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltrans 2e-74
cd03351254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-a 5e-24
PRK05289262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransfe 3e-22
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phos 1e-21
TIGR01852254 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--U 4e-21
PRK12461255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransfe 7e-21
COG1043260 COG1043, LpxA, Acyl-[acyl carrier protein] 9e-21
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltr 3e-20
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylas 4e-19
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate u 9e-18
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phos 4e-16
PRK14357448 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phos 1e-13
PRK14360450 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phos 3e-11
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-li 2e-09
PRK14356456 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phos 2e-08
PRK14353446 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phos 2e-07
PRK14352482 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phos 6e-07
PRK14358481 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phos 3e-06
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 5e-06
cd03349145 cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The 3e-05
pfam0461372 pfam04613, LpxD, UDP-3-O-[3-hydroxymyristoyl] glucosami 1e-16
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophospho 9e-13
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 1e-10
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 1e-08
KOG1461 673 KOG1461, KOG1461, KOG1461, Translation initiation facto 1e-07
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphat 1e-07
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)- 3e-06
KOG1461 673 KOG1461, KOG1461, KOG1461, Translation initiation facto 4e-06
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransferase 4e-06
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 8e-06
COG2171271 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransfe 3e-05
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): 2e-04
cd03350139 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine- 2e-04
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-H 4e-04
KOG1462433 KOG1462, KOG1462, KOG1462, Translation initiation facto 5e-04
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT c 0.001
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix (Lbeta 0.001
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransferase 0.003
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 8e-12
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 6e-11
COG1045194 COG1045, CysE, Serine acetyltransferase [Amino acid tra 2e-10
TIGR03532231 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dica 2e-10
PLN02357360 PLN02357, PLN02357, serine acetyltransferase 5e-10
KOG4750269 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [ 1e-09
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)- 2e-09
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parall 4e-09
PRK10502182 PRK10502, PRK10502, putative acyl transferase; Provisio 4e-09
KOG1461 673 KOG1461, KOG1461, KOG1461, Translation initiation facto 5e-08
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT c 5e-08
PLN02694294 PLN02694, PLN02694, serine O-acetyltransferase 8e-08
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch supe 2e-07
cd05825107 cd05825, LbH_wcaF_like, wcaF-like: This group is compos 3e-07
PLN02739355 PLN02739, PLN02739, serine acetyltransferase 4e-07
TIGR01172162 TIGR01172, cysE, serine O-acetyltransferase 5e-07
COG4801 277 COG4801, COG4801, Predicted acyltransferase [General fu 3e-06
COG2171271 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransfe 5e-05
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix (Lbeta 5e-05
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylas 7e-05
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): 2e-04
PRK09527203 PRK09527, lacA, galactoside O-acetyltransferase; Review 3e-04
cd03359161 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); D 6e-04
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate u 9e-04
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-H 9e-04
cd03350139 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine- 0.002
KOG1322371 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylas 0.002
TIGR02353 695 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthet 0.002
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophospho 0.003
cd0465281 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-ter 0.004
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 5e-10
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 7e-05
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 2e-09
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 8e-09
TIGR03532231 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dica 3e-07
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-li 2e-06
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-li 9e-06
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parall 1e-05
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): 2e-05
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 4e-05
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, cen 4e-05
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)- 2e-04
KOG1322371 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylas 2e-04
KOG1460407 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylas 5e-04
TIGR02353695 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthet 5e-04
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parall 6e-04
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch supe 0.001
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-H 0.001
PRK10502182 PRK10502, PRK10502, putative acyl transferase; Provisio 0.002
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parall 0.003
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT c 0.004
cd03357169 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) 0.004
PRK10092183 PRK10092, PRK10092, maltose O-acetyltransferase; Provis 5e-08
cd03357169 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) 2e-06
PRK14359430 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phos 7e-07
PRK09451456 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phos 2e-05
PRK09451456 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phos 6e-04
PRK11830272 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxyl 7e-04
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, cen 7e-04
>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162561 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|179994 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130911 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31245 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|172831 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184644 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|172832 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|172834 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|100040 cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>gnl|CDD|146990 pfam04613, LpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD Back     alignment and domain information
>gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|36675 KOG1462, KOG1462, KOG1462, Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|179140 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|31247 COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|177989 PLN02357, PLN02357, serine acetyltransferase Back     alignment and domain information
>gnl|CDD|39947 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|182500 PRK10502, PRK10502, putative acyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|178297 PLN02694, PLN02694, serine O-acetyltransferase Back     alignment and domain information
>gnl|CDD|30459 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|100063 cd05825, LbH_wcaF_like, wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>gnl|CDD|178340 PLN02739, PLN02739, serine acetyltransferase Back     alignment and domain information
>gnl|CDD|130240 TIGR01172, cysE, serine O-acetyltransferase Back     alignment and domain information
>gnl|CDD|34410 COG4801, COG4801, Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|181930 PRK09527, lacA, galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>gnl|CDD|36536 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|162818 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|36536 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|36673 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162818 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|30459 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|182500 PRK10502, PRK10502, putative acyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|100047 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>gnl|CDD|182235 PRK10092, PRK10092, maltose O-acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100047 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>gnl|CDD|184645 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183330 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 347 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransfer
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 100.0
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 100.0
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 100.0
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 100.0
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 99.98
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 100.0
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 100.0
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 100.0
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 100.0
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 100.0
COG1043260 LpxA Acyl-[acyl carrier protein] 100.0
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 100.0
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.97
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.96
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.96
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.96
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.95
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.95
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.94
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.94
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.93
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.92
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.91
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.89
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.89
COG1043260 LpxA Acyl-[acyl carrier protein] 99.86
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.82
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.74
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.64
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.56
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 99.52
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.3
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 99.26
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 99.15
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.14
KOG3121184 consensus 98.75
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 100.0
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.97
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.97
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.75
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 99.53
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.96
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.96
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.96
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.93
PRK13627196 carnitine operon protein CaiE; Provisional 99.93
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.91
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.91
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 99.9
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.9
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 99.89
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.89
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.89
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 99.88
PRK10092183 maltose O-acetyltransferase; Provisional 99.88
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.85
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.85
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.84
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 99.83
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.82
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 99.79
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.77
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.77
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 99.76
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 99.73
PRK11132273 cysE serine acetyltransferase; Provisional 99.71
KOG4042190 consensus 98.15
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.93
KOG4750269 consensus 99.75
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.45
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.38
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 99.36
TIGR02353719 NRPS_term_dom non-ribosomal peptide synthetase terminal 99.3
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.68
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.67
KOG4750269 consensus 98.58
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.57
KOG4042190 consensus 97.94
COG4801277 Predicted acyltransferase [General function prediction 97.65
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 97.57
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 97.3
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.91
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.88
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.78
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 99.7
TIGR02353 719 NRPS_term_dom non-ribosomal peptide synthetase terminal 99.22
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.84
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.42
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.37
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 99.34
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.32
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.26
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.25
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 99.14
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 99.13
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 99.07
PRK10092183 maltose O-acetyltransferase; Provisional 99.06
KOG1460407 consensus 99.03
PRK01884435 consensus 98.98
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.7
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 98.64
KOG1460407 consensus 98.39
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 98.23
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 97.1
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.73
PRK13627196 carnitine operon protein CaiE; Provisional 99.72
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.69
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.61
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.56
KOG1461 673 consensus 99.56
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.47
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.45
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 99.29
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 99.24
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 99.22
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 99.19
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 99.1
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 98.89
pfam0461372 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.64
PRK10773 452 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 98.27
PRK00139 481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 96.57
PRK11930 824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 96.32
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 95.27
KOG1461 673 consensus 99.46
PRK04928405 consensus 99.21
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.19
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 99.03
PRK03282406 consensus 99.02
PRK01884435 consensus 98.83
PRK03701431 consensus 98.7
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 98.58
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 97.95
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.3
PRK03282406 consensus 99.26
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 99.19
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 99.17
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 99.14
PRK04928405 consensus 99.02
PRK03701431 consensus 99.01
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 98.97
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 98.9
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 98.87
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 98.4
COG4801277 Predicted acyltransferase [General function prediction 97.08
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.24
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.22
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 99.2
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 98.87
KOG1462433 consensus 98.69
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 97.74
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 97.61
PRK11132273 cysE serine acetyltransferase; Provisional 99.18
KOG1322371 consensus 98.99
KOG1462433 consensus 98.92
KOG1322371 consensus 98.59
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 98.46
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.87
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 98.38
KOG3121184 consensus 98.05
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 98.35
pfam07959414 Fucokinase L-fucokinase. In the salvage pathway of GDP- 90.99
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137 This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>KOG3121 consensus Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>KOG4750 consensus Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>KOG4042 consensus Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974 Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728 This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881 The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>pfam04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD Back     alignment and domain information
>PRK10773 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information