254780772

254780772

surface antigen (D15)

GeneID in NCBI database:8209778Locus tag:CLIBASIA_03315
Protein GI in NCBI database:254780772Protein Accession:YP_003065185.1
Gene range:+(489425, 491770)Protein Length:781aa
Gene description:surface antigen (D15)
COG prediction:[M] Outer membrane protein/protective antigen OMA87
KEGG prediction:omp; surface antigen (D15); K07277 outer membrane protein
SEED prediction:Outer membrane protein assembly factor YaeT precursor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccHHHHHHHccccccccccHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEccEEEEEEEEccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEEEcccEEEEEEEEEEcccccccHHHHHHHHcccHHcEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccccEEEEEEEccccEEEEEEEEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEEcccEEEEEEEEEEccccccHHHHHHHccccccccccHHHHHHHHHHHHccccEEEEEEEEccccccccEEEEEEEEEEccccEEEEEEccccccEEEEEEEEEEcccccccEEEEEEEEEccccEEEEEEEEEEcccccccEEEEEEEEEEccccccEEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEccccccccccccccccccccEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEccccccccHHHEEEEccccccccEEccccccccccccccccEEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEcccccccccccccccccEEEEEEEEEEEEccEEEEEEEEEEEccccccccEEEEEEEEEEcc
cccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHcccHHHHHHcccccccccccHHHHHHHHHHHHHccccccEEEEEcccEEEEEEEEccEEEEEEEEccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccEcEEEEEEEEcccccEEEEEEEEEcccEEEEEEEEEEccccccHHHHHHHHcccccccHHccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccccEEEEEEEccccEEEEcEEEEEEccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccEEEEEccccccccccEEEEEEEEccccEEEEEEEEEEcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEEEccccEEEEEEEEEccccEEEEEEEEcccccccccEEEEEEEcccccEEEEEEEEccccEcccccEEcEEEEEEcccccccccccccccEEEEEEEccccEEEEEEEEEEEEcccccccccHHHHHHHHHcccccccEEEEEEEEEccccccccccccEEEEEEEEEEEcccccEEEEEEEEcEEEEEcccccEEEEEEEEEccccccccccccEEEEEEccccccEEccccccccccccccccccccHEEEEEEEEEcccccccccccEEEEEEEEccccccccccccccccccccccEEEEEEEEEEEEcccccEEEEEcEEccccccccEEEEEEEccccc
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSavygsntsIVRRIEirgatnvgkevilsripvvvgqsisdadlDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFfsgnnnlkddqlKMIVRSrsaaaydedtvnaDVHNIKQAYASIGYLNVMVKVQhhsispttLNITYVIEEGVKAKINSIRfvgnknyshARLERVISIRTsgyfsfgktdvyskermsFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQidegeiytvgnISIQSTLQEIQKKTLLSLIRIrsgnlynpqeikESSEKISKYFfsgerpfvrvKTRINRDFAKRIVDIEYlidqgsplyvkrieiegndqsyDSVIRRELelsegdpinySMIERAKRRIMATgyfsevnisqlpandvsdYVILRVSVKQLSAGSVGIATNyevdkgmgveghiddnnffgQGYRARLAAGfgrhavqnytfsvedpyflgspisagfdlqkthledgsldindesAAVRMIVPITESISTSFKYDLRFLQYgaisekekipSIYTTLIehgkfsshsiSQSIIyntldnpivprkgmlisssydyagfggdsqyhrigsraSYFYLlsddsdivgslrfgygcvipsnknlqlfdqfsvssnyylrgfaykgigprvdkkyaiggkiyssasaavsfpmplvperaglrgaffvdsATLYANHVAlgadklegndsfwRVSTGVEimwnsplgmmgvyygiplrhregdkIQQFGFRIGNRM
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEirgatnvgkevilsripvvvgqsisdADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFfsgnnnlkddqLKMIVRSRSAAaydedtvnaDVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSirfvgnknyshaRLERVisirtsgyfsfGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIrsgnlynpqeikesSEKISKyffsgerpfvrvktrinrdfakrivdieylidqgsplyvKRIEiegndqsydsvirrelelsegdpinysMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVkqlsagsvgIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPItesistsfkYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVAlgadklegndSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM
****************KYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM
*****EDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIG***
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM
MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTSFKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISSSYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYANHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNRM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target781 surface antigen (D15) [Candidatus Liberibacter asiaticu
61619810781 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
61619816781 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
255957541781 putative group 1 outer membrane protein [Candidatus Lib 1 0.0
61619801781 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
158906315781 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
55380591781 putative group 1 outer membrane protein [Candidatus Lib 1 0.0
165882007781 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
209916651624 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
209916666581 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
209916672581 outer membrane protein [Candidatus Liberibacter asiatic 1 0.0
>gi|61619810|gb|AAX47431.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 781 Back     alignment and organism information
 Score = 1582 bits (4096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/781 (99%), Positives = 781/781 (100%)

Query: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60
           MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG
Sbjct: 1   MHKSTEDFRRIKRLLEKYFPRSFQMGFIILFYAIFGLSAVYGSNTSIVRRIEIRGATNVG 60

Query: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120
           KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF
Sbjct: 61  KEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF 120

Query: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180
           FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT
Sbjct: 121 FSGNNNLKDDQLKMIVRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPT 180

Query: 181 TLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240
           TLNITYVIEEGVKAKIN+IRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD
Sbjct: 181 TLNITYVIEEGVKAKINTIRFVGNKNYSHARLERVISIRTSGYFSFGKTDVYSKERMSFD 240

Query: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300
           EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK
Sbjct: 241 EEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQIDEGEIYTVGNISIQSTLQEIQKK 300

Query: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360
           TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID
Sbjct: 301 TLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDIEYLID 360

Query: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420
           QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ
Sbjct: 361 QGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQ 420

Query: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480
           LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF
Sbjct: 421 LPANDVSDYVILRVSVKQLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGF 480

Query: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540
           GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS
Sbjct: 481 GRHAVQNYTFSVEDPYFLGSPISAGFDLQKTHLEDGSLDINDESAAVRMIVPITESISTS 540

Query: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600
           FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS
Sbjct: 541 FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKGMLISS 600

Query: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660
           SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS
Sbjct: 601 SYDYAGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSS 660

Query: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720
           NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA
Sbjct: 661 NYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLVPERAGLRGAFFVDSATLYA 720

Query: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780
           NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR
Sbjct: 721 NHVALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKIQQFGFRIGNR 780

Query: 781 M 781
           M
Sbjct: 781 M 781


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|61619816|gb|AAX47432.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 781 Back     alignment and organism information
>gi|255957541|dbj|BAH96605.1| putative group 1 outer membrane protein [Candidatus Liberibacter asiaticus] Length = 781 Back     alignment and organism information
>gi|61619801|gb|AAX47430.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 781 Back     alignment and organism information
>gi|158906315|gb|ABW82728.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 781 Back     alignment and organism information
>gi|55380591|gb|AAV50034.1| putative group 1 outer membrane protein [Candidatus Liberibacter asiaticus] Length = 781 Back     alignment and organism information
>gi|165882007|gb|ABY71267.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 781 Back     alignment and organism information
>gi|209916651|gb|ACI96017.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 624 Back     alignment and organism information
>gi|209916666|gb|ACI96025.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 581 Back     alignment and organism information
>gi|209916672|gb|ACI96028.1| outer membrane protein [Candidatus Liberibacter asiaticus] Length = 581 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target781 surface antigen (D15) [Candidatus Liberibacter asiaticu
TIGR03303741 TIGR03303, OM_YaeT, outer membrane protein assembly com 1e-161
PRK11067803 PRK11067, PRK11067, outer membrane protein assembly fac 4e-73
COG4775766 COG4775, COG4775, Outer membrane protein/protective ant 1e-139
pfam01103317 pfam01103, Bac_surface_Ag, Surface antigen 5e-45
COG0729594 COG0729, COG0729, Outer membrane protein [Cell envelope 2e-25
KOG2602457 KOG2602, KOG2602, KOG2602, Predicted cell surface prote 3e-18
pfam0724478 pfam07244, Surf_Ag_VNR, Surface antigen variable number 8e-07
pfam0724478 pfam07244, Surf_Ag_VNR, Surface antigen variable number 2e-06
pfam0724478 pfam07244, Surf_Ag_VNR, Surface antigen variable number 1e-05
pfam0724478 pfam07244, Surf_Ag_VNR, Surface antigen variable number 2e-05
TIGR00992718 TIGR00992, 3a0901s03IAP75, chloroplast envelope protein 3e-05
COG2831554 COG2831, FhaC, Hemolysin activation/secretion protein [ 1e-04
>gnl|CDD|163210 TIGR03303, OM_YaeT, outer membrane protein assembly complex, YaeT protein Back     alignment and domain information
>gnl|CDD|182941 PRK11067, PRK11067, outer membrane protein assembly factor YaeT; Provisional Back     alignment and domain information
>gnl|CDD|34388 COG4775, COG4775, Outer membrane protein/protective antigen OMA87 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144626 pfam01103, Bac_surface_Ag, Surface antigen Back     alignment and domain information
>gnl|CDD|31073 COG0729, COG0729, Outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|37813 KOG2602, KOG2602, KOG2602, Predicted cell surface protein homologous to bacterial outer membrane proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|148699 pfam07244, Surf_Ag_VNR, Surface antigen variable number repeat Back     alignment and domain information
>gnl|CDD|148699 pfam07244, Surf_Ag_VNR, Surface antigen variable number repeat Back     alignment and domain information
>gnl|CDD|148699 pfam07244, Surf_Ag_VNR, Surface antigen variable number repeat Back     alignment and domain information
>gnl|CDD|148699 pfam07244, Surf_Ag_VNR, Surface antigen variable number repeat Back     alignment and domain information
>gnl|CDD|130065 TIGR00992, 3a0901s03IAP75, chloroplast envelope protein translocase, IAP75 family Back     alignment and domain information
>gnl|CDD|32659 COG2831, FhaC, Hemolysin activation/secretion protein [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 781 surface antigen (D15) [Candidatus Liberibacter asiaticu
PRK11067801 outer membrane protein assembly factor YaeT; Provisiona 100.0
TIGR03303741 OM_YaeT outer membrane protein assembly complex, YaeT p 100.0
COG4775766 Outer membrane protein/protective antigen OMA87 [Cell e 100.0
COG0729594 Outer membrane protein [Cell envelope biogenesis, outer 100.0
pfam01103317 Bac_surface_Ag Surface antigen. This entry includes the 100.0
TIGR03303741 OM_YaeT outer membrane protein assembly complex, YaeT p 100.0
PRK11067801 outer membrane protein assembly factor YaeT; Provisiona 100.0
COG4775766 Outer membrane protein/protective antigen OMA87 [Cell e 100.0
TIGR00992768 3a0901s03IAP75 chloroplast envelope protein translocase 100.0
COG2831554 FhaC Hemolysin activation/secretion protein [Intracellu 100.0
KOG2602457 consensus 100.0
pfam03865404 ShlB Haemolysin secretion/activation protein ShlB/FhaC/ 99.94
COG2831554 FhaC Hemolysin activation/secretion protein [Intracellu 99.4
COG0729594 Outer membrane protein [Cell envelope biogenesis, outer 99.33
pfam0724478 Surf_Ag_VNR Surface antigen variable number repeat. Thi 99.09
pfam0847976 POTRA_2 POTRA domain, ShlB-type. The POTRA domain (for 98.37
pfam0724478 Surf_Ag_VNR Surface antigen variable number repeat. Thi 98.78
TIGR00992768 3a0901s03IAP75 chloroplast envelope protein translocase 98.73
PRK05529255 cell division protein FtsQ; Provisional 98.54
pfam06898383 YqfD Putative stage IV sporulation protein YqfD. This f 98.19
TIGR02876406 spore_yqfD sporulation protein YqfD; InterPro: IPR01069 97.08
COG1589269 FtsQ Cell division septal protein [Cell envelope biogen 97.99
pfam0847867 POTRA_1 POTRA domain, FtsQ-type. FtsQ/DivIB bacterial d 97.21
pfam0847976 POTRA_2 POTRA domain, ShlB-type. The POTRA domain (for 97.71
PRK10049818 pgaA outer membrane protein PgaA; Provisional 93.97
PRK10775274 cell division protein FtsQ; Provisional 92.36
>PRK11067 outer membrane protein assembly factor YaeT; Provisional Back     alignment and domain information
>TIGR03303 OM_YaeT outer membrane protein assembly complex, YaeT protein Back     alignment and domain information
>COG4775 Outer membrane protein/protective antigen OMA87 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0729 Outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam01103 Bac_surface_Ag Surface antigen Back     alignment and domain information
>TIGR03303 OM_YaeT outer membrane protein assembly complex, YaeT protein Back     alignment and domain information
>PRK11067 outer membrane protein assembly factor YaeT; Provisional Back     alignment and domain information
>COG4775 Outer membrane protein/protective antigen OMA87 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00992 3a0901s03IAP75 chloroplast envelope protein translocase, IAP75 family; InterPro: IPR005689 Chloroplast function requires the import of nuclear encoded proteins from the cytoplasm across the chloroplast double membrane Back     alignment and domain information
>COG2831 FhaC Hemolysin activation/secretion protein [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2602 consensus Back     alignment and domain information
>pfam03865 ShlB Haemolysin secretion/activation protein ShlB/FhaC/HecB Back     alignment and domain information
>COG2831 FhaC Hemolysin activation/secretion protein [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0729 Outer membrane protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam07244 Surf_Ag_VNR Surface antigen variable number repeat Back     alignment and domain information
>pfam08479 POTRA_2 POTRA domain, ShlB-type Back     alignment and domain information
>pfam07244 Surf_Ag_VNR Surface antigen variable number repeat Back     alignment and domain information
>TIGR00992 3a0901s03IAP75 chloroplast envelope protein translocase, IAP75 family; InterPro: IPR005689 Chloroplast function requires the import of nuclear encoded proteins from the cytoplasm across the chloroplast double membrane Back     alignment and domain information
>PRK05529 cell division protein FtsQ; Provisional Back     alignment and domain information
>pfam06898 YqfD Putative stage IV sporulation protein YqfD Back     alignment and domain information
>TIGR02876 spore_yqfD sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information
>COG1589 FtsQ Cell division septal protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam08478 POTRA_1 POTRA domain, FtsQ-type Back     alignment and domain information
>pfam08479 POTRA_2 POTRA domain, ShlB-type Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10775 cell division protein FtsQ; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target781 surface antigen (D15) [Candidatus Liberibacter asiaticu
3efc_A395 Crystal Structure Of Yaet Periplasmic Domain Length 1e-48
2qcz_A335 Structure Of N-Terminal Domain Of E. Coli Yaet Leng 1e-44
2v9h_A164 Solution Structure Of An Escherichia Coli Yaet Tand 2e-38
2x8x_X235 Structure Of The N-Terminal Domain Of Omp85 From Th 1e-15
3mc8_A316 Potra1-3 Of The Periplasmic Domain Of Omp85 From An 1e-12
3og5_A166 Crystal Structure Of Bama Potra45 Tandem Length = 1 0.002
2x8x_X235 Structure Of The N-Terminal Domain Of Omp85 From Th 6e-04
3mc8_A316 Potra1-3 Of The Periplasmic Domain Of Omp85 From An 0.004
2qdz_A554 Structure Of The Membrane Protein Fhac: A Member Of 0.001
>gi|218681824|pdb|3EFC|A Chain A, Crystal Structure Of Yaet Periplasmic Domain Length = 395 Back     alignment and structure
 Score =  199 bits (506), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 93/389 (23%), Positives = 172/389 (44%), Gaps = 4/389 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +   +V+ I   G   V     L  +PV  G +++D D+ + ++ ++A G F +V++   
Sbjct: 4   AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRD 63

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIV---RSRSAAAYDEDTVNADVHNIKQA 159
              L++ + ER  I  + FSGN ++KDD LK  +     R   + D  T+      ++  
Sbjct: 64  GDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDF 123

Query: 160 YASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVIS-I 218
           Y S+G  +  VK     +    +++  V +EGV A+I  I  VGN  ++   L       
Sbjct: 124 YYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLR 183

Query: 219 RTSGYFSFGKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQVLFDKQKSGYVLIFQID 278
               +++      Y K++++ D E +R++Y DRGYA   + S  +        + +    
Sbjct: 184 DEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNI 243

Query: 279 EGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFV 338
                   +    S         +  L +I  G LYN  ++ +  + I K        + 
Sbjct: 244 TEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYP 303

Query: 339 RVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYS 398
           RV++    + A + V +   +D G+  YV++I  EGND S D+V+RRE+   EG  +   
Sbjct: 304 RVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSD 363

Query: 399 MIERAKRRIMATGYFSEVNISQLPANDVS 427
           ++++ K R+   G+F  V+          
Sbjct: 364 LVDQGKERLNRLGFFETVDTDTQRVPGSP 392


>gi|158430133|pdb|2QCZ|A Chain A, Structure Of N-Terminal Domain Of E. Coli Yaet Length = 335 Back     alignment and structure
>gi|291463419|pdb|2X8X|X Chain X, Structure Of The N-Terminal Domain Of Omp85 From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus Length = 235 Back     alignment and structure
>gi|294979844|pdb|3MC8|A Chain A, Potra1-3 Of The Periplasmic Domain Of Omp85 From Anabaena Length = 316 Back     alignment and structure
>gi|312208014|pdb|3OG5|A Chain A, Crystal Structure Of Bama Potra45 Tandem Length = 166 Back     alignment and structure
>gi|291463419|pdb|2X8X|X Chain X, Structure Of The N-Terminal Domain Of Omp85 From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus Length = 235 Back     alignment and structure
>gi|294979844|pdb|3MC8|A Chain A, Potra1-3 Of The Periplasmic Domain Of Omp85 From Anabaena Length = 316 Back     alignment and structure
>gi|158430141|pdb|2QDZ|A Chain A, Structure Of The Membrane Protein Fhac: A Member Of The Omp85TPSB TRANSPORTER FAMILY Length = 554 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target781 surface antigen (D15) [Candidatus Liberibacter asiaticu
3efc_A395 OMP85, outer membrane protein assembly factor YAET; pot 1e-54
2qdz_A554 TPSB transporter FHAC; beta barrel, potra domain, membr 1e-32
2qdz_A554 TPSB transporter FHAC; beta barrel, potra domain, membr 0.002
3og5_A166 Outer membrane protein assembly complex, YAET Pro; potr 2e-06
2qdf_A335 OMP85, outer membrane protein assembly factor YAET; pot 9e-30
2qdf_A335 OMP85, outer membrane protein assembly factor YAET; pot 2e-04
3mc9_A316 ALR2269 protein; polypeptide transport associated, potr 1e-23
2x8x_X235 TLR1789 protein, OMP85; chaperone, TOC75, protein targe 2e-22
3mc9_A316 ALR2269 protein; polypeptide transport associated, potr 2e-19
2x8x_X235 TLR1789 protein, OMP85; chaperone, TOC75, protein targe 3e-20
3mc9_A316 ALR2269 protein; polypeptide transport associated, potr 0.002
2x8x_X235 TLR1789 protein, OMP85; chaperone, TOC75, protein targe 8e-14
2x8x_X235 TLR1789 protein, OMP85; chaperone, TOC75, protein targe 2e-06
3og5_A166 Outer membrane protein assembly complex, YAET Pro; potr 4e-22
3og5_A166 Outer membrane protein assembly complex, YAET Pro; potr 8e-10
>3efc_A OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Length = 395 Back     alignment and structure
 Score =  210 bits (535), Expect = 1e-54
 Identities = 103/391 (26%), Positives = 183/391 (46%), Gaps = 6/391 (1%)

Query: 43  SNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIV 102
           +   +V+ I   G   V     L  +PV  G +++D D+ + ++ ++A G F +V++   
Sbjct: 4   AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRD 63

Query: 103 DSVLIIDLIERKIINHLFFSGNNNLKDDQLKMIVRSRSAAA---YDEDTVNADVHNIKQA 159
              L++ + ER  I  + FSGN ++KDD LK  + +         D  T+      ++  
Sbjct: 64  GDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDF 123

Query: 160 YASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLERVISIR 219
           Y S+G  +  VK     +    +++  V +EGV A+I  I  VGN  ++   L     +R
Sbjct: 124 YYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLR 183

Query: 220 TSGYFSFGKTD-VYSKERMSFDEEAIRAFYHDRGYAAVKV-SSQVLFDKQKSGYVLIFQI 277
               +     D  Y K++++ D E +R++Y DRGYA   + S+QV     K G  +   I
Sbjct: 184 DEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNI 243

Query: 278 DEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPF 337
            EG+ Y +  + +   L       +  L +I  G LYN  ++ +  + I K        +
Sbjct: 244 TEGDQYKLSGVEVSGNL-AGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAY 302

Query: 338 VRVKTRINRDFAKRIVDIEYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINY 397
            RV++    + A + V +   +D G+  YV++I  EGND S D+V+RRE+   EG  +  
Sbjct: 303 PRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGS 362

Query: 398 SMIERAKRRIMATGYFSEVNISQLPANDVSD 428
            ++++ K R+   G+F  V+          D
Sbjct: 363 DLVDQGKERLNRLGFFETVDTDTQRVPGSPD 393


>2qdz_A TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Length = 554 Back     alignment and structure
>2qdz_A TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Length = 554 Back     alignment and structure
>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Length = 166 Back     alignment and structure
>2qdf_A OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Length = 335 Back     alignment and structure
>2qdf_A OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Length = 335 Back     alignment and structure
>3mc9_A ALR2269 protein; polypeptide transport associated, potra, outer bacterial MEM protein membrane transport, beta barrel biogenesis, membran; 2.20A {Nostoc SP} PDB: 3mc8_A Length = 316 Back     alignment and structure
>2x8x_X TLR1789 protein, OMP85; chaperone, TOC75, protein targeting; 1.97A {Thermosynechococcus elongatus} Length = 235 Back     alignment and structure
>3mc9_A ALR2269 protein; polypeptide transport associated, potra, outer bacterial MEM protein membrane transport, beta barrel biogenesis, membran; 2.20A {Nostoc SP} PDB: 3mc8_A Length = 316 Back     alignment and structure
>2x8x_X TLR1789 protein, OMP85; chaperone, TOC75, protein targeting; 1.97A {Thermosynechococcus elongatus} Length = 235 Back     alignment and structure
>3mc9_A ALR2269 protein; polypeptide transport associated, potra, outer bacterial MEM protein membrane transport, beta barrel biogenesis, membran; 2.20A {Nostoc SP} PDB: 3mc8_A Length = 316 Back     alignment and structure
>2x8x_X TLR1789 protein, OMP85; chaperone, TOC75, protein targeting; 1.97A {Thermosynechococcus elongatus} Length = 235 Back     alignment and structure
>2x8x_X TLR1789 protein, OMP85; chaperone, TOC75, protein targeting; 1.97A {Thermosynechococcus elongatus} Length = 235 Back     alignment and structure
>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Length = 166 Back     alignment and structure
>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Length = 166 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target781 surface antigen (D15) [Candidatus Liberibacter asiaticu
3efc_A395 OMP85, outer membrane protein assembly factor YAET; pot 100.0
3mc9_A316 ALR2269 protein; polypeptide transport associated, potr 100.0
2qdf_A335 OMP85, outer membrane protein assembly factor YAET; pot 100.0
2qdz_A554 TPSB transporter FHAC; beta barrel, potra domain, membr 100.0
2qdf_A335 OMP85, outer membrane protein assembly factor YAET; pot 100.0
3efc_A395 OMP85, outer membrane protein assembly factor YAET; pot 100.0
2x8x_X235 TLR1789 protein, OMP85; chaperone, TOC75, protein targe 100.0
2x8x_X235 TLR1789 protein, OMP85; chaperone, TOC75, protein targe 99.97
3og5_A166 Outer membrane protein assembly complex, YAET Pro; potr 99.97
3og5_A166 Outer membrane protein assembly complex, YAET Pro; potr 99.88
3mc9_A316 ALR2269 protein; polypeptide transport associated, potr 99.67
2qdz_A554 TPSB transporter FHAC; beta barrel, potra domain, membr 99.5
2vh2_A255 FTSQ, cell division protein FTSQ; potra, cell cycle; 3. 96.4
2vh1_A220 FTSQ, cell division protein FTSQ; potra, membrane, sept 96.11
>3efc_A OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=586.17  Aligned_cols=387  Identities=26%  Similarity=0.461  Sum_probs=367.0

Q ss_pred             HCCCCEEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEEEECCEEEEEE
Q ss_conf             11465268589996650079889999748789882688999999999996798003899986998999999365365799
Q gi|254780772|r   41 YGSNTSIVRRIEIRGATNVGKEVILSRIPVVVGQSISDADLDHAVKNIYAMGYFSNVKIKIVDSVLIIDLIERKIINHLF  120 (781)
Q Consensus        41 ~~~~~~~i~~I~i~G~~~i~~~~i~~~~~~~~G~~~~~~~i~~~i~~l~~~g~F~~v~~~~~~~~l~~~v~e~p~i~~i~  120 (781)
                      +.|++++|++|+|+||+++++++|++++++++|++++++.+++++++||+||+|+||++..++..|+|.|+|+|+|.+|.
T Consensus         2 a~a~~~~I~~I~i~G~~~i~~~~i~~~~~~~~G~~~~~~~i~~~ik~L~~tg~F~~V~i~~~g~~l~i~V~E~p~i~~i~   81 (395)
T 3efc_A            2 AMAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASIT   81 (395)
T ss_dssp             ----CCCEEEEECSCCSSSCHHHHHHTCSCCTTSCCCTHHHHHHHHHHHHHCCEEEEEEECCSSEEEEEEEECCEEEEEE
T ss_pred             CCCCCCEEEEEEEECCCCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCEEEEEEEECCEEEEEE
T ss_conf             87777189789999984179999997468999993798999999999996798026999962999999999446160379


Q ss_pred             EECCCCCCHHHHHHH---HHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCEEEEEEEECCCCEEEE
Q ss_conf             956543698899887---30057863799999999999999999729700179987643389842588986036632467
Q gi|254780772|r  121 FSGNNNLKDDQLKMI---VRSRSAAAYDEDTVNADVHNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKIN  197 (781)
Q Consensus       121 ~~Gn~~~~~~~l~~~---~~~~~g~~~~~~~~~~~~~~i~~~y~~~Gy~~a~V~~~~~~~~~~~v~i~~~I~EG~~~~I~  197 (781)
                      |+||+.++++.|++.   ++++.|+++++..+++++++|+++|.++||++|.|.++.++.++++++|+|.|+||++++|.
T Consensus        82 ~~Gn~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Y~~~Gy~~~~v~~~~~~~~~~~v~v~~~I~Eg~~~kI~  161 (395)
T 3efc_A           82 FSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQ  161 (395)
T ss_dssp             EESCTTSCHHHHHHHHHHHTCCSSSCCCGGGHHHHHHHHHHHHHTTTCCSCEEEEECCBCTTSEEEEEEEEECCCCCCCC
T ss_pred             EECCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEEEEECCCCCCCE
T ss_conf             99762134445433210134344441235668999999999998708632210237752467505544432005542213


Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCCEEE
Q ss_conf             78750443110122221110012211244-56664310233334578888887542322100123-10124555541012
Q gi|254780772|r  198 SIRFVGNKNYSHARLERVISIRTSGYFSF-GKTDVYSKERMSFDEEAIRAFYHDRGYAAVKVSSQ-VLFDKQKSGYVLIF  275 (781)
Q Consensus       198 ~I~f~Gn~~f~~~~L~~~~~~k~~~~~~~-~~~~~~~~~~l~~D~~~l~~~Y~~~GY~d~~V~~~-~~~~~~~~~~~i~~  275 (781)
                      +|.|+||+.|++++|++.|.+++.+||++ ..++.|+++.++.|+++|++||+++||+|++|..+ +...+++..+.|+|
T Consensus       162 ~I~f~Gn~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~l~~~Y~~~Gy~d~~v~~~~~~~~~~~~~v~i~i  241 (395)
T 3efc_A          162 QINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTV  241 (395)
T ss_dssp             CCEEESCCSSCTTTTGGGCCCCSSCCSCCSCTTTHHHHHHHHHHHHHHHHHHHHTTCTTCEEEECCCEECTTSCSEECEE
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCHHHHHHCCCCCCCCCHHCCCHHHHHHHHHHCCEEEEEECCCEEEECCCCCCCEEEE
T ss_conf             78983353331155554443011100111013433222000031888888985567589997021689815777515753


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCEECCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             20222210000012333444557677775321169962112100000000000023445642011233223434404665
Q gi|254780772|r  276 QIDEGEIYTVGNISIQSTLQEIQKKTLLSLIRIRSGNLYNPQEIKESSEKISKYFFSGERPFVRVKTRINRDFAKRIVDI  355 (781)
Q Consensus       276 ~I~EG~~y~i~~i~i~g~~~~~~~~~l~~~~~~k~G~~~~~~~~~~~~~~i~~~y~~~GY~fa~v~~~~~~d~~~~~vdi  355 (781)
                      .|+||+||++++|+|.|+. ..+.+++.+.+.+++|++|+...++++.++|.+.|.++||++++|.+.+..+.++++|+|
T Consensus       242 ~i~EG~~y~v~~i~i~Gn~-~~~~~~l~~~l~~~~g~~f~~~~~~~~~~~i~~~y~~~GY~~a~v~~~~~~~~~~~~v~l  320 (395)
T 3efc_A          242 NITEGDQYKLSGVEVSGNL-AGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKL  320 (395)
T ss_dssp             EEECCCCCEEEEECCBSCC-TTCHHHHHHTCCCCSSCBCCHHHHHHHHHHHHHHHHHTTCSSCEEEEEEEEETTTTEEEE
T ss_pred             ECCCCEEEEEEEEEEECCC-HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEECCCCCEEEE
T ss_conf             0244404788776650572-000134555543204632340121002457899997517532124663045056738999


Q ss_pred             EEECCCCCCCEEECCCCCCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             5412333220110033334320033210010010000000123444566677651012344533254435654
Q gi|254780772|r  356 EYLIDQGSPLYVKRIEIEGNDQSYDSVIRRELELSEGDPINYSMIERAKRRIMATGYFSEVNISQLPANDVSD  428 (781)
Q Consensus       356 ~~~I~eg~~~~i~~I~I~GN~~T~d~VIrrel~~~~Gd~~~~~~i~~s~~~L~~lg~F~~V~i~~~~~~~~~~  428 (781)
                      .|.|+||+++||++|+|.||++|+|+||||+|.++|||+||+.++++|++||++||||++|++.+.|+++.+|
T Consensus       321 ~~~I~eg~~~~v~~I~I~GN~~T~d~vIrrel~~~~Gd~~~~~~l~~s~~~L~~lg~F~~V~i~~~~v~~~~D  393 (395)
T 3efc_A          321 RVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPD  393 (395)
T ss_dssp             EEEEECCCCCCC-------------------------------------------------------------
T ss_pred             EEEECCCCCEEEEEEEEECCCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC
T ss_conf             9998448818999999988873655641320036998647999999999999846997600546403888989



>3mc9_A ALR2269 protein; polypeptide transport associated, potra, outer bacterial MEM protein membrane transport, beta barrel biogenesis, membran; 2.20A {Nostoc SP} PDB: 3mc8_A Back     alignment and structure
>2qdf_A OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>2qdz_A TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Back     alignment and structure
>2qdf_A OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2x8x_X TLR1789 protein, OMP85; chaperone, TOC75, protein targeting; 1.97A {Thermosynechococcus elongatus} Back     alignment and structure
>2x8x_X TLR1789 protein, OMP85; chaperone, TOC75, protein targeting; 1.97A {Thermosynechococcus elongatus} Back     alignment and structure
>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Back     alignment and structure
>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Back     alignment and structure
>3mc9_A ALR2269 protein; polypeptide transport associated, potra, outer bacterial MEM protein membrane transport, beta barrel biogenesis, membran; 2.20A {Nostoc SP} PDB: 3mc8_A Back     alignment and structure
>2qdz_A TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Back     alignment and structure
>2vh2_A FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica} Back     alignment and structure
>2vh1_A FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 781 surface antigen (D15) [Candidatus Liberibacter asi
2qdz_A_1-45_210-554390 (A:1-45,A:210-554) TPSB transporter FHAC; beta bar 3e-25
3efc_A_248-395148 (A:248-395) OMP85, outer membrane protein assembly 8e-21
2qdz_A_46-209164 (A:46-209) TPSB transporter FHAC; beta barrel, pot 5e-16
3efc_A_248-395148 (A:248-395) OMP85, outer membrane protein assembly 2e-15
2qdz_A_46-209164 (A:46-209) TPSB transporter FHAC; beta barrel, pot 6e-12
3efc_A_248-395148 (A:248-395) OMP85, outer membrane protein assembly 0.002
2vh2_A_1-9797 (A:1-97) FTSQ, cell division protein FTSQ; potra, 0.001
2qdf_A_158-24891 (A:158-248) OMP85, outer membrane protein assembly 1e-16
3efc_A_156-24792 (A:156-247) OMP85, outer membrane protein assembly 5e-16
2qdf_A_249-33587 (A:249-335) OMP85, outer membrane protein assembly 2e-11
3efc_A_74-15582 (A:74-155) OMP85, outer membrane protein assembly 2e-10
2qdf_A_76-15782 (A:76-157) OMP85, outer membrane protein assembly 4e-10
2qdf_A_158-24891 (A:158-248) OMP85, outer membrane protein assembly 2e-06
3efc_A_156-24792 (A:156-247) OMP85, outer membrane protein assembly 5e-06
2qdf_A_249-33587 (A:249-335) OMP85, outer membrane protein assembly 3e-08
3efc_A_74-15582 (A:74-155) OMP85, outer membrane protein assembly 1e-08
2qdf_A_76-15782 (A:76-157) OMP85, outer membrane protein assembly 6e-09
2qdz_A_46-209164 (A:46-209) TPSB transporter FHAC; beta barrel, pot 1e-05
2qdf_A_1-7575 (A:1-75) OMP85, outer membrane protein assembly fa 7e-13
3efc_A_1-7373 (A:1-73) OMP85, outer membrane protein assembly fa 1e-12
2qdf_A_249-33587 (A:249-335) OMP85, outer membrane protein assembly 0.003
2qdf_A_1-7575 (A:1-75) OMP85, outer membrane protein assembly fa 7e-12
3efc_A_1-7373 (A:1-73) OMP85, outer membrane protein assembly fa 7e-11
2qdf_A_249-33587 (A:249-335) OMP85, outer membrane protein assembly 1e-10
>2qdz_A (A:1-45,A:210-554) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis}Length = 390 Back     alignment and structure
 Score =  111 bits (278), Expect = 3e-25
 Identities = 39/361 (10%), Positives = 80/361 (22%), Gaps = 37/361 (10%)

Query: 438 QLSAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFG------RHAVQNYTFS 491
           ++S G          +        +  N+  G      L  G          A +NY   
Sbjct: 48  RVSLGMDNSGPGTPENGRYKYNASVTANDLLGLNDTLGLYIGNRYYRDAGHDAERNYDLM 107

Query: 492 VEDPYFLGSPISAGFDLQKTHLEDGSLDIND-----ESAAVRMIVPITESISTSFKYDLR 546
              P                +L               S  ++    +     + F     
Sbjct: 108 YSVPLGRTRLDLQTGYSTYRNLLKTRYGQYQSAGNSRSFGLKATRLLYRDTRSQFSVYGG 167

Query: 547 FLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTLDNPIVPRKG--MLISSSYDY 604
                  +         ++            S     N     +   +G  +       Y
Sbjct: 168 LKLRQNKNYLAGTRLDVSSKHYSDVTVGMQYSTQRGANAYFGDLSFTRGVGVNNGKYAAY 227

Query: 605 AGFGGDSQYHRIGSRASYFYLLSDDSDIVGSLRFGYGCVIPSNKNLQLFDQFSVSSNYYL 664
              G      R     ++   ++     +       G    S + L    Q +V   Y +
Sbjct: 228 DERGPQGNVSRFNGSLAWTRYMALAGQPI-QWASQLG-FQYSRQQLLNSYQITVGDEYTV 285

Query: 665 RGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPL--VPERAGLRGAFFVDSATLYANH 722
           RG+           + +  G      S  ++ P+    + ++A +      D   L    
Sbjct: 286 RGYNL---------RTSQSGDSGVYLSNTLTVPVQFSLLGKQASVAPFVGADVGALK--- 333

Query: 723 VALGADKLEGNDSFWRVSTGVEIMWNSPLGMMGVYYGIPLRHREGDKI---QQFGFRIGN 779
                       +         + ++ P   M   Y  P+  + G             G 
Sbjct: 334 -----SNHPDARTIRMAGLAAGVRFDLPYARMSFTYSKPVGAQPGGAPRAPVWLYINAGL 388

Query: 780 R 780
            
Sbjct: 389 S 389


>3efc_A (A:248-395) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 148 Back     alignment and structure
>2qdz_A (A:46-209) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis}Length = 164 Back     alignment and structure
>3efc_A (A:248-395) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 148 Back     alignment and structure
>2qdz_A (A:46-209) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis}Length = 164 Back     alignment and structure
>3efc_A (A:248-395) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 148 Back     alignment and structure
>2vh2_A (A:1-97) FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica}Length = 97 Back     alignment and structure
>2qdf_A (A:158-248) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 91 Back     alignment and structure
>3efc_A (A:156-247) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 92 Back     alignment and structure
>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 87 Back     alignment and structure
>3efc_A (A:74-155) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 82 Back     alignment and structure
>2qdf_A (A:76-157) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 82 Back     alignment and structure
>2qdf_A (A:158-248) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 91 Back     alignment and structure
>3efc_A (A:156-247) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 92 Back     alignment and structure
>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 87 Back     alignment and structure
>3efc_A (A:74-155) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 82 Back     alignment and structure
>2qdf_A (A:76-157) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 82 Back     alignment and structure
>2qdz_A (A:46-209) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis}Length = 164 Back     alignment and structure
>2qdf_A (A:1-75) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 75 Back     alignment and structure
>3efc_A (A:1-73) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 73 Back     alignment and structure
>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 87 Back     alignment and structure
>2qdf_A (A:1-75) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 75 Back     alignment and structure
>3efc_A (A:1-73) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli}Length = 73 Back     alignment and structure
>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_ALength = 87 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target781 surface antigen (D15) [Candidatus Liberibacter asiaticu
2qdz_A_1-45_210-554390 TPSB transporter FHAC; beta barrel, potra domain, 100.0
2qdz_A_46-209164 TPSB transporter FHAC; beta barrel, potra domain, 99.9
3efc_A_248-395148 OMP85, outer membrane protein assembly factor YAET 99.87
2qdz_A_46-209164 TPSB transporter FHAC; beta barrel, potra domain, 99.79
3efc_A_248-395148 OMP85, outer membrane protein assembly factor YAET 99.7
2qdf_A_158-24891 OMP85, outer membrane protein assembly factor YAET 99.67
3efc_A_156-24792 OMP85, outer membrane protein assembly factor YAET 99.64
2qdf_A_76-15782 OMP85, outer membrane protein assembly factor YAET 99.2
3efc_A_74-15582 OMP85, outer membrane protein assembly factor YAET 99.17
2qdf_A_76-15782 OMP85, outer membrane protein assembly factor YAET 99.5
3efc_A_74-15582 OMP85, outer membrane protein assembly factor YAET 99.49
2qdf_A_249-33587 OMP85, outer membrane protein assembly factor YAET 99.43
2qdf_A_158-24891 OMP85, outer membrane protein assembly factor YAET 99.22
3efc_A_156-24792 OMP85, outer membrane protein assembly factor YAET 99.19
2qdf_A_1-7575 OMP85, outer membrane protein assembly factor YAET 99.45
3efc_A_1-7373 OMP85, outer membrane protein assembly factor YAET 99.36
2vh2_A_1-9797 FTSQ, cell division protein FTSQ; potra, cell cycl 97.79
2vh1_A_1-7171 FTSQ, cell division protein FTSQ; potra, membrane, 96.89
2qdf_A_249-33587 OMP85, outer membrane protein assembly factor YAET 99.39
3efc_A_1-7373 OMP85, outer membrane protein assembly factor YAET 99.14
2qdf_A_1-7575 OMP85, outer membrane protein assembly factor YAET 99.12
>2qdz_A (A:1-45,A:210-554) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Back     alignment and structure
Probab=100.00  E-value=1.2e-36  Score=256.80  Aligned_cols=316  Identities=13%  Similarity=0.083  Sum_probs=228.1

Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCEEEEEEECC------CCEEEEEEEECCCCCCCCCCCCCCCCCC-
Q ss_conf             211111111122332110000011123332344220037874112------2111134541123577754310011113-
Q gi|254780772|r  440 SAGSVGIATNYEVDKGMGVEGHIDDNNFFGQGYRARLAAGFGRHA------VQNYTFSVEDPYFLGSPISAGFDLQKTH-  512 (781)
Q Consensus       440 ~tg~~~~g~gys~~~g~~~~~~~~~~Nl~G~G~~l~l~~~~~~~~------~~~~~~s~~~P~~~~~~~s~~~~~~~~~-  512 (781)
                      .++.+..++||++..++.+.++++++|++|.|+.+++.+..+...      .+.+.++|..|+................ 
T Consensus        50 ~~~~~~~g~g~~~~~~~~~~~~~~~~nl~g~g~~~~~~~~~s~~~~~~~~~~~~~~~~y~~p~~~~~~~~~~~~~~~~~~  129 (390)
T 2qdz_A           50 SLGMDNSGPGTPENGRYKYNASVTANDLLGLNDTLGLYIGNRYYRDAGHDAERNYDLMYSVPLGRTRLDLQTGYSTYRNL  129 (390)
T ss_dssp             EEEEEECSCSSSCSSCEEEEEEEEEECSSSSSCEEEEEEEEECCSCCSSCEEEEEEEEEEEEETTEEEEEEEEEEEEECC
T ss_pred             CCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCEEEEEEECCCCCCCCCCCCEEEEEEEECCCCCCCEEEEEEEEEEEEC
T ss_conf             33334345774456740366667763567877368999872443355555521234552023332114888776541000


Q ss_pred             ----CCCCCCCCCCCCCEEEEEEECCCCEEEE--ECCCEEEEEEECCCCCCCCCHHHHHHHCCCCCEEEEEEEEECCCCC
Q ss_conf             ----3333343233320245542025430235--4041257764014675442011122101585024678843215542
Q gi|254780772|r  513 ----LEDGSLDINDESAAVRMIVPITESISTS--FKYDLRFLQYGAISEKEKIPSIYTTLIEHGKFSSHSISQSIIYNTL  586 (781)
Q Consensus       513 ----~~~~~y~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~dtr  586 (781)
                          .....+........+.+++++.......  +++.+.+...........      ............+...+.++.+
T Consensus       130 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~  203 (390)
T 2qdz_A          130 LKTRYGQYQSAGNSRSFGLKATRLLYRDTRSQFSVYGGLKLRQNKNYLAGTR------LDVSSKHYSDVTVGMQYSTQRG  203 (390)
T ss_dssp             CSSSSCCCCCEEEEEEEEEEEEEEEECCSSEEEEEEEEEEEEEEEEECCTTS------CCCEEEEEEEEEEEEEEEEECS
T ss_pred             CCCCCCCEECCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEEECCEECCCCC------CCCCCEEEEEEEEEEEEEEECC
T ss_conf             3565421001330369987887642026745688988899987100026731------1135404667888654688846


Q ss_pred             CCCCCCCCCEEEEEEECC------CCCCCCCEEEEEEEEEEEEEEECCCE-EEEEEEEEEEEEEECCCCCCCCHHEEEEC
Q ss_conf             011002465156542024------56555420366663004799935880-99999999789851699741230127507
Q gi|254780772|r  587 DNPIVPRKGMLISSSYDY------AGFGGDSQYHRIGSRASYFYLLSDDS-DIVGSLRFGYGCVIPSNKNLQLFDQFSVS  659 (781)
Q Consensus       587 D~~~~Pt~G~~~~~~~~~------a~~g~d~~f~k~~~~~~~y~~l~~~~-~l~~~~~~g~~~~~~~~~~lp~~erF~lG  659 (781)
                      |+..+|+.|+........      ..++++.+|.++.+++++|+|+.... .+.+..  +++... .++.+|++++|++|
T Consensus       204 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~l~~~~~~~~~~~--~~~~~~-~~~~lp~~~~f~lG  280 (390)
T 2qdz_A          204 ANAYFGDLSFTRGVGVNNGKYAAYDERGPQGNVSRFNGSLAWTRYMALAGQPIQWAS--QLGFQY-SRQQLLNSYQITVG  280 (390)
T ss_dssp             SEEEEEEEEEEECCCC--------------CCCEEEEEEEEEEEEEEETTEEEEEEE--EEEEEE-CSSCSSSSEECCSC
T ss_pred             CCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCEEEEE--EEEEEE-CCCCCCCCCEEEEC
T ss_conf             860414434212543345544332356787735999999999986024566402688--998886-68877754369857


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEECCCC--CCCCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCE
Q ss_conf             897140212686155037997222147899999999614565--654537999999767741566667754445676642
Q gi|254780772|r  660 SNYYLRGFAYKGIGPRVDKKYAIGGKIYSSASAAVSFPMPLV--PERAGLRGAFFVDSATLYANHVALGADKLEGNDSFW  737 (781)
Q Consensus       660 G~~svRGy~~~~iGP~~~~~~~~GG~~~~~~s~E~r~pl~~~--~~~~~l~~~~F~D~G~v~~~~~~~~~~~~~~~~~~~  737 (781)
                      |.++||||..+.+         .+|+.++.+++|||+|++..  .....+++++|+|+|+||+.......        .+
T Consensus       281 G~~~lRGy~~~~~---------~~Gd~~~~~~~Elr~~l~~~~~~~~~~l~~~~F~D~G~v~~~~~~~~~--------~~  343 (390)
T 2qdz_A          281 DEYTVRGYNLRTS---------QSGDSGVYLSNTLTVPVQFSLLGKQASVAPFVGADVGALKSNHPDART--------IR  343 (390)
T ss_dssp             CCCCCTTCCCCCS---------CCSSCSSCCEESEEEEEEEEEEECCSSCEEEEEEEEEEEECSSSSCCE--------EE
T ss_pred             CCCCEECCCCCCC---------CCCCCEEEEEEEEEEECCCCCCCCCCEEEEEEEEEEEEECCCCCCCCC--------CE
T ss_conf             9985726178985---------464436999999999754545667625999999999995357888888--------76


Q ss_pred             EEEEEEEEEEECCCCCEEEEEEEECCCCCCC---EEEEEEEEEEECC
Q ss_conf             4799999997557001589988722677876---0258999641059
Q gi|254780772|r  738 RVSTGVEIMWNSPLGMMGVYYGIPLRHREGD---KIQQFGFRIGNRM  781 (781)
Q Consensus       738 r~s~G~Glr~~tP~Gpirld~a~pl~~~~~D---~~~~f~FsiG~~f  781 (781)
                      +.|+|+||||.+|+|||||+||+|+++.+++   ...+|+|+||+.|
T Consensus       344 ~~s~G~Glr~~~~~~~l~l~~a~~l~~~~~~~~~~~~~~~f~ig~~F  390 (390)
T 2qdz_A          344 MAGLAAGVRFDLPYARMSFTYSKPVGAQPGGAPRAPVWLYINAGLSF  390 (390)
T ss_dssp             EEEEEEEEEECCSSEEEEEEEEEECSCSCSSSCCCCSEEEEEEEEEC
T ss_pred             EEEEEEEEEEEECCEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEC
T ss_conf             99999999999388789999998767898887688659999998289



>2qdz_A (A:46-209) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Back     alignment and structure
>3efc_A (A:248-395) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdz_A (A:46-209) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Back     alignment and structure
>3efc_A (A:248-395) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:158-248) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:156-247) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:76-157) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:74-155) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:76-157) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:74-155) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>2qdf_A (A:158-248) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:156-247) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:1-75) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:1-73) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2vh2_A (A:1-97) FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica} Back     alignment and structure
>2vh1_A (A:1-71) FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:1-73) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:1-75) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure