254780773

254780773

zinc metallopeptidase

GeneID in NCBI database:8209779Locus tag:CLIBASIA_03320
Protein GI in NCBI database:254780773Protein Accession:YP_003065186.1
Gene range:+(488309, 489358)Protein Length:349aa
Gene description:zinc metallopeptidase
COG prediction:[M] Predicted membrane-associated Zn-dependent proteases 1
KEGG prediction:zinc metallopeptidase; K11749 regulator of sigma E protease [EC:3.4.24.-]
SEED prediction:Membrane-associated zinc metalloprotease
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Periplasmic Stress Response
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM4 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEHEEEccccEEEEEEccccEEEEEEEEEEccEEEcccccccHHHHccccccHHHHHHcccccHHHHHHHHHHHHHHccccccccEEcccccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHccccEEEEEEEEccccEEEEEEEEEcccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHHHHHHHHHHHHHHccHHEEHHcccEEEEEEEcccHHHEEEccccccEEEEEEEEcccEEEccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccEEEEEcccEcccHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEcccEccccccccEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLsfsvgfgpeligitsrsgvrwkvsliplggyvsfsedekdMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFyntgvmkpvvsnvspaspaaiagvkkgdciisldgitvsafeevapyvrenplhEISLVLYREHVGVLHLKVMPRLqdtvdrfgikrqvpsvgisfsydetklhSRTVLQSFSRGLDEISSITRGFLGVLssafgkdtrlnqisgPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMnllpipildggHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELigitsrsgvrwkVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDtvdrfgikrqvpsvgisfsydetklhSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCiilflfflgiRNDIYGLMQ
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDE****SFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVLHLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGVLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDGGHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target349 zinc metallopeptidase [Candidatus Liberibacter asiaticu
140063939349 zinc metalloprotease [Candidatus Liberibacter asiaticus 1 0.0
315121990348 zinc metallopeptidase [Candidatus Liberibacter solanace 1 1e-125
55380590148 hypothetical zinc metalloprotease [Candidatus Liberibac 1 2e-72
55380586265 hypothetical zinc metalloprotease [Candidatus Liberibac 1 3e-72
222148856373 zinc metallopeptidase [Agrobacterium vitis S4] Length = 1 1e-62
218682882377 putative transmembrane protease [Rhizobium etli CIAT 89 1 2e-62
209549188375 membrane-associated zinc metalloprotease [Rhizobium leg 1 6e-62
86357540375 zinc metallopeptidase protein [Rhizobium etli CFN 42] L 1 2e-61
116251983377 transmembrane protease [Rhizobium leguminosarum bv. vic 1 3e-61
241204510377 membrane-associated zinc metalloprotease [Rhizobium leg 1 6e-61
>gi|140063939|gb|ABO82465.1| zinc metalloprotease [Candidatus Liberibacter asiaticus] Length = 349 Back     alignment and organism information
 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/349 (99%), Positives = 348/349 (99%)

Query: 1   MFWLDCFLLYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60
           MFWLDCFLLYTVSLIIIVVI +FGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV
Sbjct: 1   MFWLDCFLLYTVSLIIIVVIGQFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKV 60

Query: 61  SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120
           SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP
Sbjct: 61  SLIPLGGYVSFSEDEKDMRSFFCAAPWKKILTVLAGPLANCVMAILFFTFFFYNTGVMKP 120

Query: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180
           VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL
Sbjct: 121 VVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENPLHEISLVLYREHVGVL 180

Query: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240
           HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG
Sbjct: 181 HLKVMPRLQDTVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLG 240

Query: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300
           VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG
Sbjct: 241 VLSSAFGKDTRLNQISGPVGIARIAKNFFDHGFNAYIAFLAMFSWAIGFMNLLPIPILDG 300

Query: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349
           GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ
Sbjct: 301 GHLITFLLEMIRGKSLGVSVTRVITRMGLCIILFLFFLGIRNDIYGLMQ 349


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121990|ref|YP_004062479.1| zinc metallopeptidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 348 Back     alignment and organism information
>gi|55380590|gb|AAV50033.1| hypothetical zinc metalloprotease [Candidatus Liberibacter asiaticus] Length = 148 Back     alignment and organism information
>gi|55380586|gb|AAV50030.1| hypothetical zinc metalloprotease [Candidatus Liberibacter africanus] Length = 265 Back     alignment and organism information
>gi|222148856|ref|YP_002549813.1| zinc metallopeptidase [Agrobacterium vitis S4] Length = 373 Back     alignment and organism information
>gi|218682882|ref|ZP_03530483.1| putative transmembrane protease [Rhizobium etli CIAT 894] Length = 377 Back     alignment and organism information
>gi|209549188|ref|YP_002281105.1| membrane-associated zinc metalloprotease [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 375 Back     alignment and organism information
>gi|86357540|ref|YP_469432.1| zinc metallopeptidase protein [Rhizobium etli CFN 42] Length = 375 Back     alignment and organism information
>gi|116251983|ref|YP_767821.1| transmembrane protease [Rhizobium leguminosarum bv. viciae 3841] Length = 377 Back     alignment and organism information
>gi|241204510|ref|YP_002975606.1| membrane-associated zinc metalloprotease [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 377 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target349 zinc metallopeptidase [Candidatus Liberibacter asiaticu
cd06163182 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 protea 5e-31
cd05709180 cd05709, S2P-M50, Site-2 protease (S2P) class of zinc m 7e-18
pfam02163205 pfam02163, Peptidase_M50, Peptidase family M50 4e-14
cd06161208 cd06161, S2P-M50_SpoIVFB, SpoIVFB Site-2 protease (S2P) 2e-05
cd06159263 cd06159, S2P-M50_PDZ_Arch, Uncharacterized Archaeal hom 2e-04
TIGR00054420 TIGR00054, TIGR00054, RIP metalloprotease RseP 3e-28
PRK10779449 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisi 2e-20
TIGR00054420 TIGR00054, TIGR00054, RIP metalloprotease RseP 3e-23
PRK10779449 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisi 1e-21
KOG2921484 KOG2921, KOG2921, KOG2921, Intramembrane metalloproteas 1e-06
cd06163182 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 protea 6e-18
cd05709180 cd05709, S2P-M50, Site-2 protease (S2P) class of zinc m 2e-09
pfam02163205 pfam02163, Peptidase_M50, Peptidase family M50 5e-11
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacterial a 3e-10
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspin-lik 5e-06
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal pro 6e-06
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO- 2e-05
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologo 1e-04
KOG3129231 KOG3129, KOG3129, KOG3129, 26S proteasome regulatory co 1e-04
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protease, D 2e-04
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope bioge 3e-04
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typically 0.001
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protease, D 0.002
PRK10139455 PRK10139, PRK10139, serine endoprotease; Provisional 0.002
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) 0.003
PRK10942473 PRK10942, PRK10942, serine endoprotease; Provisional 3e-04
PRK10898353 PRK10898, PRK10898, serine endoprotease; Provisional 0.003
COG0750375 COG0750, COG0750, Predicted membrane-associated Zn-depe 2e-41
>gnl|CDD|100084 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|100078 cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|111095 pfam02163, Peptidase_M50, Peptidase family M50 Back     alignment and domain information
>gnl|CDD|100082 cd06161, S2P-M50_SpoIVFB, SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation Back     alignment and domain information
>gnl|CDD|100080 cd06159, S2P-M50_PDZ_Arch, Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|161683 TIGR00054, TIGR00054, RIP metalloprotease RseP Back     alignment and domain information
>gnl|CDD|182723 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>gnl|CDD|161683 TIGR00054, TIGR00054, RIP metalloprotease RseP Back     alignment and domain information
>gnl|CDD|182723 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>gnl|CDD|38132 KOG2921, KOG2921, KOG2921, Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|100084 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|100078 cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|111095 pfam02163, Peptidase_M50, Peptidase family M50 Back     alignment and domain information
>gnl|CDD|29046 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|29044 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|29045 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|128524 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|29042 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|38339 KOG3129, KOG3129, KOG3129, 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162670 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|31136 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|30614 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162670 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|144258 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|182855 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|31093 COG0750, COG0750, Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 349 zinc metallopeptidase [Candidatus Liberibacter asiaticu
PRK10779449 zinc metallopeptidase; Provisional 100.0
TIGR00054463 TIGR00054 membrane-associated zinc metalloprotease, put 100.0
COG0750375 Predicted membrane-associated Zn-dependent proteases 1 100.0
cd06163182 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), 100.0
pfam02163205 Peptidase_M50 Peptidase family M50. 100.0
cd05709180 S2P-M50 Site-2 protease (S2P) class of zinc metalloprot 100.0
cd06159263 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of S 99.94
cd06161208 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc m 99.8
cd06164227 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zi 99.8
LOAD_S2Pmetalloprt148 consensus 99.9
KOG2921484 consensus 99.77
cd06162277 S2P-M50_PDZ_SREBP Sterol regulatory element-binding pro 99.66
cd06160183 S2P-M50_like_2 Uncharacterized homologs of Site-2 prote 99.6
cd06158181 S2P-M50_like_1 Uncharacterized homologs of Site-2 prote 99.56
pfam01434192 Peptidase_M41 Peptidase family M41. 96.69
COG1994230 SpoIVFB Zn-dependent proteases [General function predic 96.17
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and plant z 99.45
TIGR02037484 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolyt 99.35
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaeal zin 99.23
PRK10139455 serine endoprotease; Provisional 99.14
PRK10942474 serine endoprotease; Provisional 99.12
PRK10898355 serine endoprotease; Provisional 99.1
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processing-, 99.06
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON serine 99.0
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like serine p 98.99
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated with ar 98.98
TIGR02860423 spore_IV_B stage IV sporulation protein B; InterPro: IP 98.96
TIGR02038358 protease_degS periplasmic serine peptidase DegS; InterP 98.95
TIGR02037484 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolyt 98.71
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous region) 98.63
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis, out 98.61
PRK10139455 serine endoprotease; Provisional 98.57
PRK10942474 serine endoprotease; Provisional 98.56
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacterial-sp 98.43
PRK11186 673 carboxy-terminal protease; Provisional 98.37
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Also cal 98.37
PRK10779449 zinc metallopeptidase; Provisional 98.24
COG0265347 DegQ Trypsin-like serine proteases, typically periplasm 98.22
KOG3129231 consensus 98.22
pfam0059580 PDZ PDZ domain (Also known as DHR or GLGF). PDZ domains 98.16
cd0099282 PDZ_signaling PDZ domain found in a variety of Eumetazo 98.12
TIGR00054463 TIGR00054 membrane-associated zinc metalloprotease, put 97.82
COG3975558 Predicted protease with the C-terminal PDZ domain [Gene 97.62
KOG1320473 consensus 97.6
KOG1421 955 consensus 97.58
KOG3209984 consensus 97.49
pfam04495280 GRASP55_65 GRASP55/65 family. GRASP55 (Golgi reassembly 97.0
PRK09681319 putative type II secretion protein GspC; Provisional 96.94
TIGR01713281 typeII_sec_gspC general secretion pathway protein C; In 96.87
KOG3532 1051 consensus 96.56
TIGR00225361 prc C-terminal processing peptidase; InterPro: IPR00444 96.3
COG3031275 PulC Type II secretory pathway, component PulC [Intrace 96.25
KOG3553124 consensus 96.16
KOG3580 1027 consensus 96.02
KOG3834 462 consensus 95.89
KOG3552 1298 consensus 95.87
KOG3834 462 consensus 95.67
KOG3209 984 consensus 95.67
KOG0606 1205 consensus 94.73
KOG1421955 consensus 94.25
KOG3651 429 consensus 93.84
KOG3580 1027 consensus 93.47
KOG3549 505 consensus 93.38
KOG3605829 consensus 92.95
KOG1892 1629 consensus 92.4
KOG3551 506 consensus 90.23
COG3480342 SdrC Predicted secreted protein containing a PDZ domain 98.56
COG1994230 SpoIVFB Zn-dependent proteases [General function predic 98.42
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 95.84
KOG3542 1283 consensus 94.33
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 92.57
>PRK10779 zinc metallopeptidase; Provisional Back     alignment and domain information
>TIGR00054 TIGR00054 membrane-associated zinc metalloprotease, putative; InterPro: IPR004387 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>pfam02163 Peptidase_M50 Peptidase family M50 Back     alignment and domain information
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation Back     alignment and domain information
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation Back     alignment and domain information
>LOAD_S2Pmetalloprt consensus Back     alignment and domain information
>KOG2921 consensus Back     alignment and domain information
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism Back     alignment and domain information
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>pfam01434 Peptidase_M41 Peptidase family M41 Back     alignment and domain information
>COG1994 SpoIVFB Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>TIGR02037 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B; InterPro: IPR014219 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine peptidase DegS; InterPro: IPR011783 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>TIGR02037 degP_htrA_DO protease Do; InterPro: IPR011782 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PRK10779 zinc metallopeptidase; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3129 consensus Back     alignment and domain information
>pfam00595 PDZ PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>TIGR00054 TIGR00054 membrane-associated zinc metalloprotease, putative; InterPro: IPR004387 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1320 consensus Back     alignment and domain information
>KOG1421 consensus Back     alignment and domain information
>KOG3209 consensus Back     alignment and domain information
>pfam04495 GRASP55_65 GRASP55/65 family Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C; InterPro: IPR001639 The general (type II) secretion pathway (GSP) within Gram-negative bacteria is a signal sequence-dependent process responsible for protein export , , Back     alignment and domain information
>KOG3532 consensus Back     alignment and domain information
>TIGR00225 prc C-terminal processing peptidase; InterPro: IPR004447 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3553 consensus Back     alignment and domain information
>KOG3580 consensus Back     alignment and domain information
>KOG3834 consensus Back     alignment and domain information
>KOG3552 consensus Back     alignment and domain information
>KOG3834 consensus Back     alignment and domain information
>KOG3209 consensus Back     alignment and domain information
>KOG0606 consensus Back     alignment and domain information
>KOG1421 consensus Back     alignment and domain information
>KOG3651 consensus Back     alignment and domain information
>KOG3580 consensus Back     alignment and domain information
>KOG3549 consensus Back     alignment and domain information
>KOG3605 consensus Back     alignment and domain information
>KOG1892 consensus Back     alignment and domain information
>KOG3551 consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>COG1994 SpoIVFB Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG3542 consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target349 zinc metallopeptidase [Candidatus Liberibacter asiaticu
3id1_A95 Regulator of sigma E protease; hydrolase, cell inner me 8e-10
2zpm_A91 Regulator of sigma E protease; metalloproteinase, membr 2e-09
1y8t_A324 Hypothetical protein RV0983; serine protease, structura 2e-05
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, serin 2e-05
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, alpha 3e-05
1k32_A1045 Tricorn protease; protein degradation, substrate gating 4e-05
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processing pr 7e-05
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage deriv 1e-04
2joa_A105 Serine protease HTRA1; PDZ, beta-sandwich, cyclically-p 1e-04
3k1r_A192 Harmonin; protein-protein complex, alternative splicing 1e-04
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, SR-BI 1e-04
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, PDZ do 2e-04
2kl1_A94 YLBL protein; structure genomics, structural genomics, 2e-04
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, protein 2e-04
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetyl 2e-04
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, PDZ do 2e-04
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; coil 3e-04
2hga_A125 Conserved protein MTH1368; GFT structural genomics, PSI 5e-04
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Ratt 9e-04
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1.50A { 0.001
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducing pro 0.001
3i18_A100 LMO2051 protein; alpha-beta protein, structural genomic 0.001
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} 0.002
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- RF1; 0.002
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta protein, 0.002
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, structura 0.002
2eei_A106 PDZ domain-containing protein 1; regulatory factor, str 0.003
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta-stran 0.003
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1 0.003
3k50_A403 Putative S41 protease; structural genomics, joint cente 0.003
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ doma 0.004
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, caspase a 1e-07
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- bindi 0.002
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
 Score = 60.0 bits (145), Expect = 8e-10
 Identities = 19/95 (20%), Positives = 40/95 (42%), Gaps = 9/95 (9%)

Query: 117 VMKPVVSNVSPASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVREN-PLHEISLVLYRE 175
           +++PVV  ++  S AA A +  G  + ++DGI    ++ V   + +       ++ +   
Sbjct: 1   MVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTITVAPF 60

Query: 176 H--------VGVLHLKVMPRLQDTVDRFGIKRQVP 202
                    + + H    P  +D V   GI+ + P
Sbjct: 61  GSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGP 95


>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha- beta protein, hydrolase; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein binding; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2joa_A Serine protease HTRA1; PDZ, beta-sandwich, cyclically-permuted, protein binding; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein structure initiative; NMR {Geobacillus thermodenitrificans ng80-2} Length = 94 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 3dj3_A Length = 139 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A Length = 109 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, IAP-binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target349 zinc metallopeptidase [Candidatus Liberibacter asiaticu
3b4r_A224 Putative zinc metalloprotease MJ0392; intramembrane pro 99.8
2di4_A238 Zinc protease, cell division protein FTSH homolog; meta 90.93
2zpm_A91 Regulator of sigma E protease; metalloproteinase, membr 99.46
3id1_A95 Regulator of sigma E protease; hydrolase, cell inner me 99.3
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mitochond 99.18
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage deriv 99.16
2kl1_A94 YLBL protein; structure genomics, structural genomics, 99.15
2joa_A105 Serine protease HTRA1; PDZ, beta-sandwich, cyclically-p 99.13
3i18_A100 LMO2051 protein; alpha-beta protein, structural genomic 99.13
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta protein, 99.12
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, caspase a 99.11
2ytw_A118 Serine protease HTRA1; protein regulation, IGF-binding 99.08
2hga_A125 Conserved protein MTH1368; GFT structural genomics, PSI 99.06
1y8t_A324 Hypothetical protein RV0983; serine protease, structura 99.05
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, alpha 98.92
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, PDZ do 98.88
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, serin 98.88
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, PDZ do 98.83
1k32_A1045 Tricorn protease; protein degradation, substrate gating 98.09
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, protein 98.81
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ doma 98.56
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, prot 98.75
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, structura 98.72
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, serin 98.6
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, rike 98.58
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2; P 98.55
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ domain 98.54
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, stru 98.52
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structural ge 98.51
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ domain, P 98.51
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structural ge 98.51
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarc 98.5
2eaq_A90 LIM domain only protein 7; conserved hypothetical prote 98.5
2v90_A96 PDZ domain-containing protein 3; alternative splicing, 98.5
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-peptide c 98.49
3khf_A99 Microtubule-associated serine/threonine-protein kinase 98.49
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ doma 98.48
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-peptide c 98.48
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ domain, s 98.46
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, UBL c 98.45
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4 98.45
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, SR-BI 98.45
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; polymorphism, metal 98.44
2ego_A96 General receptor for phosphoinositides 1- associated sc 98.43
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein, hsc 98.43
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ doma 98.42
2vsp_A91 PDZ domain-containing protein 1; membrane, cytoplasm, p 98.42
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1.50A { 98.41
1t2m_A101 AF-6 protein; chromosomal translocation, proto-oncogene 98.4
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta-stran 98.4
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- RF1; 98.39
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosph 98.39
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Ratt 98.39
3k1r_A192 Harmonin; protein-protein complex, alternative splicing 98.39
2fne_A117 Multiple PDZ domain protein; structural protein, struct 98.39
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, struct 98.38
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, struc 98.37
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal-bind 98.37
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, 98.36
2edz_A114 PDZ domain-containing protein 1; CFTR-associated protei 98.36
2d90_A102 PDZ domain containing protein 1; structural genomics, N 98.36
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; coil 98.36
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, post sy 98.35
2eeh_A100 PDZ domain-containing protein 7; structural genomics, N 98.35
2byg_A117 Channel associated protein of synapse-110; DLG2, PDZ, P 98.34
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, cell 98.34
3cyy_A92 Tight junction protein ZO-1; protein-ligand complex, al 98.34
3e17_A88 Tight junction protein ZO-2; domain swapping, alternati 98.34
3k50_A403 Putative S41 protease; structural genomics, joint cente 98.34
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structural ge 98.34
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); beta-f 98.34
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ domain 98.34
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, signal 98.34
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, protein 98.34
2awx_A105 Synapse associated protein 97; membrane protein, synapt 98.33
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular signal 98.33
1wf7_A103 Enigma homologue protein; PDZ domain, structural genomi 98.32
2jil_A97 GRIP1 protein, glutamate receptor interacting protein-1 98.32
1ueq_A123 Membrane associated guanylate kinase inverted-2 (MAGI-2 98.32
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, human, st 98.31
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ domain 98.31
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated LIM pr 98.31
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, hydr 98.31
1uew_A114 Membrane associated guanylate kinase inverted-2 (MAGI-2 98.3
2eei_A106 PDZ domain-containing protein 1; regulatory factor, str 98.29
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hinadl, P 98.28
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskeletal- 98.28
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1 98.28
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, 98.27
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- associate 98.27
2jik_A101 Synaptojanin-2 binding protein; transmembrane, outer me 98.27
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, rike 98.27
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, 98.26
2opg_A98 Multiple PDZ domain protein; structural protein, struct 98.26
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; PDZ 98.26
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hinadl, P 98.26
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hinadl, P 98.26
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4 98.25
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, peptide, bound li 98.25
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, maguk f 98.25
1u3b_A185 Amyloid beta A4 precursor protein-binding, family A, me 98.25
2koj_A111 Partitioning defective 3 homolog; PDZ domain, structura 98.25
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSFA, na 98.25
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic tran 98.24
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal t 98.24
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, m 98.23
1u37_A89 Amyloid beta A4 precursor protein-binding, family A, me 98.23
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, rike 98.23
2o2t_A117 Multiple PDZ domain protein; structural protein, struct 98.23
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken struc 98.23
1y7n_A90 Amyloid beta A4 precursor protein-binding family A memb 98.22
1u39_A80 Amyloid beta A4 precursor protein-binding, family A, me 98.22
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetyl 98.22
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, 98.22
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 11; 98.22
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semaphorin c 98.22
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, huma 98.21
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoattracta 98.21
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, 98.2
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ domain, N 98.2
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, hete 98.2
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structural ge 98.19
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- bindi 98.18
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} 98.18
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Synthet 98.17
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structural gen 98.17
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, protein bi 98.15
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, re 98.15
2edp_A100 Fragment, shroom family member 4; APX/shroom family mem 98.15
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hinadl, P 98.15
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ domain 98.15
1uju_A111 Scribble; PDZ domain, cellular signaling, structural ge 98.14
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domain, st 98.14
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structur 98.14
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hinadl, P 98.14
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ domain, 98.13
1v6b_A118 Harmonin isoform A1; structural genomics, usher syndrom 98.13
2eno_A120 Synaptojanin-2-binding protein; mitochondrial outer mem 98.12
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ contai 98.11
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducing pro 98.11
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hinadl, P 98.1
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif contai 98.1
2djt_A104 Unnamed protein product; PDZ domain, structural genomic 98.09
1wfv_A103 Membrane associated guanylate kinase inverted-2; atroph 98.09
1um7_A113 Synapse-associated protein 102; PDZ, discs large homolo 98.09
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, G 98.08
3i4w_A104 Disks large homolog 4; alpha and beta protein, alternat 98.08
3gge_A95 PDZ domain-containing protein GIPC2; structural genomic 98.07
1v62_A117 KIAA1719 protein; structural genomics, synaptic transmi 98.06
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); structura 98.05
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattractant 98.05
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-peptide 98.05
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand comp 98.05
2yt7_A101 Amyloid beta A4 precursor protein-binding family A memb 98.04
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ domain, 98.04
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; PDZ 98.04
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affinity 98.04
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPS 98.01
1uep_A103 Membrane associated guanylate kinase inverted-2 (MAGI-2 98.01
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage derived 98.0
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoylated 97.99
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-interactin 97.98
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPPSFA, 97.97
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musculus} 97.97
1v5q_A122 GRIP1 homolog, glutamate receptor interacting protein 1 97.94
1u3b_A185 Amyloid beta A4 precursor protein-binding, family A, me 97.93
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ domain, 97.93
2vph_A100 Tyrosine-protein phosphatase non-receptor type 4; PTPN4 97.91
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, autoim 97.9
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structural ge 97.89
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, rike 97.88
1x45_A98 Amyloid beta (A4) precursor protein-binding, family A, 97.87
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ domain 97.77
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; PDZ 97.71
1ujv_A96 Membrane associated guanylate kinase inverted-2 (MAGI-2 97.63
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processing pr 97.53
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, unknow 97.15
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ domain 96.41
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: ADP; 93.9
>3b4r_A Putative zinc metalloprotease MJ0392; intramembrane protease, CBS domain, hydrolase, metal-binding, transmembrane; 3.30A {Methanocaldococcus jannaschii} Back     alignment and structure
Probab=99.80  E-value=7.7e-19  Score=148.20  Aligned_cols=71  Identities=25%  Similarity=0.535  Sum_probs=55.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCHHEEEEECCCEEEEEEEEEECCEEECCCCCCCHHHHCCCCCCC
Q ss_conf             99999999999973377999998497500455306831127860598079999771121110012445506650368421
Q gi|254780773|r    9 LYTVSLIIIVVIHEFGHYMVARLCNIRVLSFSVGFGPELIGITSRSGVRWKVSLIPLGGYVSFSEDEKDMRSFFCAAPWK   88 (349)
Q Consensus         9 ~~~~~l~~~v~iHE~GH~~~Ar~~gv~V~~FsiGfgp~l~~~~~k~~t~y~i~~~PlGgyV~~~~~e~~~~~f~~~~~~~   88 (349)
                      ...+.+.+.+++||+||+++||++|+++++                     +..+|+||+.++.+          .++++
T Consensus        42 ~~~l~l~~sv~~HE~gH~~~a~~~G~~~~~---------------------i~l~pfGg~~~~~~----------~~~~~   90 (224)
T 3b4r_A           42 VLFILLFVSVVLHELGHSYVAKKYGVKIEK---------------------ILLLPIGGVAMMDK----------IPKEG   90 (224)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCC---------------------EEECSSSCBCCCCC----------CCSSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCC---------------------EEEEECHHHHCCCC----------CCCCC
T ss_conf             999999999999999999999997995374---------------------77761112424656----------78400


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             0134211233321122111011
Q gi|254780773|r   89 KILTVLAGPLANCVMAILFFTF  110 (349)
Q Consensus        89 R~~i~~AGp~~N~ilA~iif~~  110 (349)
                      |+.|.+|||++|+++|.+.+..
T Consensus        91 ~~~ialAGPl~n~~la~~~~~~  112 (224)
T 3b4r_A           91 ELRIGIAGPLVSFIIGIVLLIV  112 (224)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CEEEEEECCHHHHHHHHHHHHH
T ss_conf             3245532208899999999987



>2di4_A Zinc protease, cell division protein FTSH homolog; metalloproteinase, hexamer-ring, hydrolase; 2.79A {Aquifex aeolicus} SCOP: a.269.1.1 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptide-binding module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein binding; 1.70A {Homo sapiens} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein structure initiative; NMR {Geobacillus thermodenitrificans ng80-2} Back     alignment and structure
>2joa_A Serine protease HTRA1; PDZ, beta-sandwich, cyclically-permuted, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, IAP-binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2ytw_A Serine protease HTRA1; protein regulation, IGF-binding protein cleavage, peptidase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha- beta protein, hydrolase; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consortium, SGC, unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.70A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; alternative splicing, membrane, cytoplasm, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 2ka9_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; polymorphism, metal-binding, enigma homolog, phosphorylation, signaling protein, zinc, PDZ domain, acetylation; 1.5A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1t2m_A AF-6 protein; chromosomal translocation, proto-oncogene, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2ain_A 1xz9_A 2exg_A* Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synaptic density, glutametergic receptors, carbohydrate metabolism, cell cycle; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genomics consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylation, SH3 domain, protein bindin; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, alternative splicing, cell junction, membrane, phosphoprotein, polymorphism; 2.40A {Homo sapiens} Back     alignment and structure
>3e17