254780774

254780774

phosphatidate cytidylyltransferase protein

GeneID in NCBI database:8209780Locus tag:CLIBASIA_03325
Protein GI in NCBI database:254780774Protein Accession:YP_003065187.1
Gene range:+(487430, 488239)Protein Length:269aa
Gene description:phosphatidate cytidylyltransferase protein
COG prediction:[I] CDP-diglyceride synthetase
KEGG prediction:cdsA; phosphatidate cytidylyltransferase protein; K00981 phosphatidate cytidylyltransferase [EC:2.7.7.41]
SEED prediction:Phosphatidate cytidylyltransferase (EC 2.7.7.41)
Pathway involved in KEGG:Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED6 TM-Helix
HMMTOP7 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM8 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK
cHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHEEHHHHHHHHHHHHHHcHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcc
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYsglpsialsslrgddakgcVIVFFVLSVVWATDIFAYFIGrfvggpkiapkisprktwsgsigglfCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGikqsgwllpghggvmdrVDGLVFSCFLMSAISFFGIATEMIGVLK
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFElalavsillsvsCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK
**QELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVL*
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooo
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK
MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKILGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALSSLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGVGVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMDRVDGLVFSCFLMSAISFFGIATEMIGVLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target269 phosphatidate cytidylyltransferase protein [Candidatus
170785428269 phosphatidate cytidylyltransferase [Candidatus Liberiba 1 1e-146
315121991268 phosphatidate cytidylyltransferase protein [Candidatus 1 3e-93
190891612276 phosphatidate cytidylyltransferase [Rhizobium etli CIAT 1 8e-53
86357539276 phosphatidate cytidylyltransferase protein [Rhizobium e 1 2e-52
327189227276 phosphatidate cytidylyltransferase protein [Rhizobium e 1 2e-52
222085862278 phosphatidate cytidylyltransferase protein [Agrobacteri 1 3e-52
227821902277 phosphatidate cytidylyltransferase [Sinorhizobium fredi 1 8e-52
241204509276 phosphatidate cytidylyltransferase [Rhizobium leguminos 1 5e-50
218670757276 phosphatidate cytidylyltransferase protein [Rhizobium e 1 1e-49
15965253277 phosphatidate cytidylyltransferase transmembrane protei 1 3e-49
>gi|170785428|gb|ACB37709.1| phosphatidate cytidylyltransferase [Candidatus Liberibacter asiaticus] Length = 269 Back     alignment and organism information
 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 267/269 (99%), Positives = 267/269 (99%)

Query: 1   MLQELKWRIVTGLVMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKI 60
           MLQELKWRIVTGL MACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKI
Sbjct: 1   MLQELKWRIVTGLAMACSFILISWIGGIWFRLWTMVMSLCIYYEWKIITGSVSLSLSEKI 60

Query: 61  LGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALS 120
           LGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALS
Sbjct: 61  LGLFTFFLVFFMIITGFFKSAFFLLMLYSFIDWMISIMKNRAFWRALGVVYSGLPSIALS 120

Query: 121 SLRGDDAKGCVIVFFVLSVVWATDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGV 180
           SLRGDDAKGCVIVFFVLSVVWA DIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGV
Sbjct: 121 SLRGDDAKGCVIVFFVLSVVWAIDIFAYFIGRFVGGPKIAPKISPRKTWSGSIGGLFCGV 180

Query: 181 GVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMD 240
           GVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMD
Sbjct: 181 GVGVALLSFFCANCFELALAVSILLSVSCQLGDLFESYIKRYFGIKQSGWLLPGHGGVMD 240

Query: 241 RVDGLVFSCFLMSAISFFGIATEMIGVLK 269
           RVDGLVFSCFLMSAISFFGIATEMIGVLK
Sbjct: 241 RVDGLVFSCFLMSAISFFGIATEMIGVLK 269


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121991|ref|YP_004062480.1| phosphatidate cytidylyltransferase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 268 Back     alignment and organism information
>gi|190891612|ref|YP_001978154.1| phosphatidate cytidylyltransferase [Rhizobium etli CIAT 652] Length = 276 Back     alignment and organism information
>gi|86357539|ref|YP_469431.1| phosphatidate cytidylyltransferase protein [Rhizobium etli CFN 42] Length = 276 Back     alignment and organism information
>gi|327189227|gb|EGE56406.1| phosphatidate cytidylyltransferase protein [Rhizobium etli CNPAF512] Length = 276 Back     alignment and organism information
>gi|222085862|ref|YP_002544393.1| phosphatidate cytidylyltransferase protein [Agrobacterium radiobacter K84] Length = 278 Back     alignment and organism information
>gi|227821902|ref|YP_002825872.1| phosphatidate cytidylyltransferase [Sinorhizobium fredii NGR234] Length = 277 Back     alignment and organism information
>gi|241204509|ref|YP_002975605.1| phosphatidate cytidylyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 276 Back     alignment and organism information
>gi|218670757|ref|ZP_03520428.1| phosphatidate cytidylyltransferase protein [Rhizobium etli GR56] Length = 276 Back     alignment and organism information
>gi|15965253|ref|NP_385606.1| phosphatidate cytidylyltransferase transmembrane protein [Sinorhizobium meliloti 1021] Length = 277 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target269 phosphatidate cytidylyltransferase protein [Candidatus
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabo 9e-29
KOG1440432 KOG1440, KOG1440, KOG1440, CDP-diacylglycerol synthase 6e-10
pfam01148259 pfam01148, CTP_transf_1, Cytidylyltransferase family 5e-30
PRK11624285 PRK11624, cdsA, CDP-diglyceride synthase; Provisional 4e-19
COG4589303 COG4589, COG4589, Predicted CDP-diglyceride synthetase/ 5e-16
PLN02953403 PLN02953, PLN02953, phosphatidate cytidylyltransferase 3e-14
PLN02594342 PLN02594, PLN02594, phosphatidate cytidylyltransferase 4e-07
PRK04032159 PRK04032, PRK04032, hypothetical protein; Provisional 1e-06
>gnl|CDD|30920 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|36653 KOG1440, KOG1440, KOG1440, CDP-diacylglycerol synthase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|110170 pfam01148, CTP_transf_1, Cytidylyltransferase family Back     alignment and domain information
>gnl|CDD|183240 PRK11624, cdsA, CDP-diglyceride synthase; Provisional Back     alignment and domain information
>gnl|CDD|34227 COG4589, COG4589, Predicted CDP-diglyceride synthetase/phosphatidate cytidylyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178539 PLN02953, PLN02953, phosphatidate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|178204 PLN02594, PLN02594, phosphatidate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|179720 PRK04032, PRK04032, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 269 phosphatidate cytidylyltransferase protein [Candidatus
PRK11624285 cdsA CDP-diglyceride synthase; Provisional 100.0
pfam01148259 CTP_transf_1 Cytidylyltransferase family. The members o 100.0
COG0575265 CdsA CDP-diglyceride synthetase [Lipid metabolism] 100.0
COG4589303 Predicted CDP-diglyceride synthetase/phosphatidate cyti 100.0
KOG1440432 consensus 100.0
pfam01864175 DUF46 Putative integral membrane protein DUF46. This ar 99.28
PRK04032164 hypothetical protein; Provisional 99.28
KOG4453269 consensus 98.77
COG0170216 SEC59 Dolichol kinase [Lipid metabolism] 98.49
KOG2468510 consensus 97.87
pfam01940224 DUF92 Integral membrane protein DUF92. Members of this 96.78
COG1836247 Predicted membrane protein [Function unknown] 96.51
KOG1440432 consensus 95.57
>PRK11624 cdsA CDP-diglyceride synthase; Provisional Back     alignment and domain information
>pfam01148 CTP_transf_1 Cytidylyltransferase family Back     alignment and domain information
>COG0575 CdsA CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>COG4589 Predicted CDP-diglyceride synthetase/phosphatidate cytidylyltransferase [General function prediction only] Back     alignment and domain information
>KOG1440 consensus Back     alignment and domain information
>pfam01864 DUF46 Putative integral membrane protein DUF46 Back     alignment and domain information
>PRK04032 hypothetical protein; Provisional Back     alignment and domain information
>KOG4453 consensus Back     alignment and domain information
>COG0170 SEC59 Dolichol kinase [Lipid metabolism] Back     alignment and domain information
>KOG2468 consensus Back     alignment and domain information
>pfam01940 DUF92 Integral membrane protein DUF92 Back     alignment and domain information
>COG1836 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG1440 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00