254780775

254780775

undecaprenyl diphosphate synthase

GeneID in NCBI database:8209781Locus tag:CLIBASIA_03330
Protein GI in NCBI database:254780775Protein Accession:YP_003065188.1
Gene range:+(486687, 487418)Protein Length:243aa
Gene description:undecaprenyl diphosphate synthase
COG prediction:[I] Undecaprenyl pyrophosphate synthase
KEGG prediction:uppS; undecaprenyl diphosphate synthase; K00806 undecaprenyl diphosphate synthase [EC:2.5.1.31]
SEED prediction:Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
Polyprenyl Diphosphate Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MVASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKKG
ccccccccccccEEEEEEcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHccHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHcccccccccEEEEcccccccccccHHHHcccEEEEEccccccccHHHHHHHHHHHHHcccccccccccc
ccHHccccccccEEEEEEccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHccHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHHHHHccccHHHccHHHHHccccccccccccEEEEEcccccccccccHHHcccEEEEccccHHHccHHHHHHHHHHHHccccHcccccccc
mvasmmsssppdhigiimdgngrwaaarglprcaghrkGIEVFNEIVAAAAEVGIKNLTIFAFSinnwrrpvSEISELVKLIKSFLKKGFYSLKKNNIKVRVIgnrlslddDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQdiesgsvcshdvdsSLIAkyldtsdvpdpdliirtggekrlSDFLLWQVAYSEfvfipeywpdfsRELFFHALNQYNlrdrrfgglskkg
mvasmmsssppdHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGfyslkknnikvrvignrlsLDDDILCVLKEaedqtrlnTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAkyldtsdvpdpDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYnlrdrrfgglskkg
MVASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKKG
********SPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRR*GG*****
**********PDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKKG
MVA*MMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRD**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKKG
MVASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKKG
MVASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target243 undecaprenyl diphosphate synthase [Candidatus Liberibac
315121992243 undecaprenyl diphosphate synthase [Candidatus Liberibac 1 1e-101
222085861247 undecaprenyl diphosphate synthase [Agrobacterium radiob 1 6e-82
209549186247 undecaprenyl diphosphate synthase [Rhizobium leguminosa 1 1e-79
190891611247 undecaprenyl pyrophosphate synthetase [Rhizobium etli C 1 2e-79
327189226247 undecaprenyl pyrophosphate synthetase protein [Rhizobiu 1 3e-79
116251981247 undecaprenyl pyrophosphate synthetase [Rhizobium legumi 1 2e-78
241204508247 undecaprenyl diphosphate synthase [Rhizobium leguminosa 1 2e-78
15888704247 undecaprenyl pyrophosphate synthase [Agrobacterium tume 1 2e-77
325292741247 Undecaprenyl pyrophosphate synthase [Agrobacterium sp. 1 6e-77
222148858248 undecaprenyl pyrophosphate synthase [Agrobacterium viti 1 1e-76
>gi|315121992|ref|YP_004062481.1| undecaprenyl diphosphate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 243 Back     alignment and organism information
 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/232 (80%), Positives = 208/232 (89%)

Query: 11  PDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRR 70
           PDHI IIMDGNGRWA  RGLPR AGHRKGIEVF+EIV  A E+G+KNLTIFAFSI+NWRR
Sbjct: 7   PDHIAIIMDGNGRWARERGLPRYAGHRKGIEVFSEIVVVATEIGVKNLTIFAFSIDNWRR 66

Query: 71  PVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGL 130
           P SEI+++VKLI SF+ KGF  LKKNN+KVRVIGNRLSLDDDIL +LKE E++T+ NTGL
Sbjct: 67  PNSEITQIVKLINSFINKGFDVLKKNNVKVRVIGNRLSLDDDILLLLKEIEEKTQFNTGL 126

Query: 131 NLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGG 190
            LFIAFNYSSRDEISRA K I +DIESG +CSHD+ SSLIA+YLDTSD+PDPDLIIRTGG
Sbjct: 127 KLFIAFNYSSRDEISRAFKGILKDIESGFLCSHDMSSSLIARYLDTSDIPDPDLIIRTGG 186

Query: 191 EKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKK 242
           EKRLSDFLLWQ AYSEFVFIPEYWPDFSRELF +A++QY LRDRRFGGLSKK
Sbjct: 187 EKRLSDFLLWQAAYSEFVFIPEYWPDFSRELFLYAVDQYALRDRRFGGLSKK 238


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085861|ref|YP_002544392.1| undecaprenyl diphosphate synthase [Agrobacterium radiobacter K84] Length = 247 Back     alignment and organism information
>gi|209549186|ref|YP_002281103.1| undecaprenyl diphosphate synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 247 Back     alignment and organism information
>gi|190891611|ref|YP_001978153.1| undecaprenyl pyrophosphate synthetase [Rhizobium etli CIAT 652] Length = 247 Back     alignment and organism information
>gi|327189226|gb|EGE56405.1| undecaprenyl pyrophosphate synthetase protein [Rhizobium etli CNPAF512] Length = 247 Back     alignment and organism information
>gi|116251981|ref|YP_767819.1| undecaprenyl pyrophosphate synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 247 Back     alignment and organism information
>gi|241204508|ref|YP_002975604.1| undecaprenyl diphosphate synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 247 Back     alignment and organism information
>gi|15888704|ref|NP_354385.1| undecaprenyl pyrophosphate synthase [Agrobacterium tumefaciens str. C58] Length = 247 Back     alignment and organism information
>gi|325292741|ref|YP_004278605.1| Undecaprenyl pyrophosphate synthase [Agrobacterium sp. H13-3] Length = 247 Back     alignment and organism information
>gi|222148858|ref|YP_002549815.1| undecaprenyl pyrophosphate synthase [Agrobacterium vitis S4] Length = 248 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target243 undecaprenyl diphosphate synthase [Candidatus Liberibac
PRK14834249 PRK14834, PRK14834, undecaprenyl pyrophosphate synthase 5e-89
PRK14830251 PRK14830, PRK14830, undecaprenyl pyrophosphate synthase 1e-86
COG0020245 COG0020, UppS, Undecaprenyl pyrophosphate synthase [Lip 1e-77
PRK14836253 PRK14836, PRK14836, undecaprenyl pyrophosphate synthase 5e-71
cd00475221 cd00475, CIS_IPPS, Cis (Z)-Isoprenyl Diphosphate Syntha 2e-67
TIGR00055226 TIGR00055, uppS, undecaprenyl diphosphate synthase 5e-64
PRK14833233 PRK14833, PRK14833, undecaprenyl pyrophosphate synthase 4e-62
PRK14838242 PRK14838, PRK14838, undecaprenyl pyrophosphate synthase 5e-62
PRK14839239 PRK14839, PRK14839, undecaprenyl pyrophosphate synthase 1e-61
PRK14831249 PRK14831, PRK14831, undecaprenyl pyrophosphate synthase 1e-60
PRK14832253 PRK14832, PRK14832, undecaprenyl pyrophosphate synthase 2e-60
KOG1602271 KOG1602, KOG1602, KOG1602, Cis-prenyltransferase [Lipid 1e-56
PRK14829243 PRK14829, PRK14829, undecaprenyl pyrophosphate synthase 3e-56
PRK14841233 PRK14841, PRK14841, undecaprenyl pyrophosphate synthase 6e-56
PRK14840250 PRK14840, PRK14840, undecaprenyl pyrophosphate synthase 2e-55
PRK14842241 PRK14842, PRK14842, undecaprenyl pyrophosphate synthase 3e-49
PRK14827296 PRK14827, PRK14827, undecaprenyl pyrophosphate synthase 6e-49
PRK14837230 PRK14837, PRK14837, undecaprenyl pyrophosphate synthase 7e-48
PRK10240229 PRK10240, PRK10240, undecaprenyl pyrophosphate synthase 3e-46
PRK14835275 PRK14835, PRK14835, undecaprenyl pyrophosphate synthase 4e-46
PRK14828256 PRK14828, PRK14828, undecaprenyl pyrophosphate synthase 3e-44
pfam01255222 pfam01255, Prenyltransf, Putative undecaprenyl diphosph 1e-83
PTZ00349322 PTZ00349, PTZ00349, dehydrodolichyl diphosphate synthet 2e-15
PTZ00349322 PTZ00349, PTZ00349, dehydrodolichyl diphosphate synthet 1e-11
KOG2818263 KOG2818, KOG2818, KOG2818, Predicted undecaprenyl dipho 2e-06
>gnl|CDD|184843 PRK14834, PRK14834, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184840 PRK14830, PRK14830, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|30370 COG0020, UppS, Undecaprenyl pyrophosphate synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|184845 PRK14836, PRK14836, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|29593 cd00475, CIS_IPPS, Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS); homodimers which catalyze the successive 1'-4 condensation of the isopentenyl diphosphate (IPP) molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl diphosphates Back     alignment and domain information
>gnl|CDD|129165 TIGR00055, uppS, undecaprenyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|184842 PRK14833, PRK14833, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184846 PRK14838, PRK14838, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|173300 PRK14839, PRK14839, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184841 PRK14831, PRK14831, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|173293 PRK14832, PRK14832, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|36815 KOG1602, KOG1602, KOG1602, Cis-prenyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184839 PRK14829, PRK14829, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|173302 PRK14841, PRK14841, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|173301 PRK14840, PRK14840, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|173303 PRK14842, PRK14842, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|173288 PRK14827, PRK14827, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|173298 PRK14837, PRK14837, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|182326 PRK10240, PRK10240, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184844 PRK14835, PRK14835, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184838 PRK14828, PRK14828, undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|144739 pfam01255, Prenyltransf, Putative undecaprenyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|185571 PTZ00349, PTZ00349, dehydrodolichyl diphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|185571 PTZ00349, PTZ00349, dehydrodolichyl diphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|38029 KOG2818, KOG2818, KOG2818, Predicted undecaprenyl diphosphate synthase [Lipid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 243 undecaprenyl diphosphate synthase [Candidatus Liberibac
TIGR00055237 uppS undecaprenyl diphosphate synthase; InterPro: IPR00 100.0
cd00475221 CIS_IPPS Cis (Z)-Isoprenyl Diphosphate Synthases (cis-I 100.0
PRK10240229 undecaprenyl pyrophosphate synthase; Provisional 100.0
pfam01255222 Prenyltransf Putative undecaprenyl diphosphate synthase 100.0
COG0020245 UppS Undecaprenyl pyrophosphate synthase [Lipid metabol 100.0
KOG1602271 consensus 100.0
KOG2818263 consensus 99.51
>TIGR00055 uppS undecaprenyl diphosphate synthase; InterPro: IPR001441 Synonym(s): Di-trans-poly-cis-undecaprenyl-diphosphate synthase, Undecaprenyl pyrophosphate synthetase, Undecaprenyl pyrophosphate synthase, UPP synthetase Di-trans-poly-cis-decaprenylcistransferase (2 Back     alignment and domain information
>cd00475 CIS_IPPS Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS); homodimers which catalyze the successive 1'-4 condensation of the isopentenyl diphosphate (IPP) molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl diphosphates Back     alignment and domain information
>PRK10240 undecaprenyl pyrophosphate synthase; Provisional Back     alignment and domain information
>pfam01255 Prenyltransf Putative undecaprenyl diphosphate synthase Back     alignment and domain information
>COG0020 UppS Undecaprenyl pyrophosphate synthase [Lipid metabolism] Back     alignment and domain information
>KOG1602 consensus Back     alignment and domain information
>KOG2818 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target243 undecaprenyl diphosphate synthase [Candidatus Liberibac
1ueh_A253 E. Coli Undecaprenyl Pyrophosphate Synthase In Comp 6e-60
1jp3_A253 Structure Of E.Coli Undecaprenyl Pyrophosphate Synt 4e-58
1x08_A253 Crystal Structure Of D26a Mutant Upps In Complex Wi 4e-58
1f75_A249 Crystal Structure Of Undecaprenyl Diphosphate Synth 8e-57
2vg2_A284 Rv2361 With Ipp Length = 284 2e-54
2d2r_A245 Crystal Structure Of Helicobacter Pylori Undecapren 1e-51
2vg1_A228 Rv1086 E,E-Farnesyl Diphosphate Complex Length = 22 2e-40
2vfw_A227 Rv1086 Native Length = 227 3e-40
gi|34810685|pdb|1UEH|A Chain A, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex With Triton X-100, Magnesium And Sulfate Length = 253 Back     alignment and structure
 Score =  235 bits (598), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 142/238 (59%), Gaps = 4/238 (1%)

Query: 6   MSSSPP----DHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIF 61
           +S   P     H+ IIMDGNGRWA  +G  R  GH+ G +     V+ AA  GI+ LT++
Sbjct: 9   LSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLY 68

Query: 62  AFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAE 121
           AFS  NW RP  E+S L++L    L     SL ++N+++R+IG+    +  +   ++++E
Sbjct: 69  AFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSE 128

Query: 122 DQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPD 181
             T  NTGL L IA NY  R +I + ++ + + ++ G++    +D  ++ +++   ++  
Sbjct: 129 ALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAP 188

Query: 182 PDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGL 239
            DL+IRTGGE R+S+FLLWQ+AY+E  F    WPDF  + F  ALN +  R+RRFGG 
Sbjct: 189 VDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGT 246


>gi|15825692|pdb|1JP3|A Chain A, Structure Of E.Coli Undecaprenyl Pyrophosphate Synthase Length = 253 Back     alignment and structure
>gi|62738380|pdb|1X08|A Chain A, Crystal Structure Of D26a Mutant Upps In Complex With Mg, Ipp And Fspp Length = 253 Back     alignment and structure
>gi|13786808|pdb|1F75|A Chain A, Crystal Structure Of Undecaprenyl Diphosphate Synthase From Micrococcus Luteus B-P 26 Length = 249 Back     alignment and structure
>gi|160286206|pdb|2VG2|A Chain A, Rv2361 With Ipp Length = 284 Back     alignment and structure
>gi|116666971|pdb|2D2R|A Chain A, Crystal Structure Of Helicobacter Pylori Undecaprenyl Pyrophosphate Synthase Length = 245 Back     alignment and structure
>gi|160286204|pdb|2VG1|A Chain A, Rv1086 E,E-Farnesyl Diphosphate Complex Length = 228 Back     alignment and structure
>gi|160286196|pdb|2VFW|A Chain A, Rv1086 Native Length = 227 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target243 undecaprenyl diphosphate synthase [Candidatus Liberibac
1f75_A249 Undecaprenyl pyrophosphate synthetase; parallel beta sh 2e-77
1ueh_A253 Undecaprenyl pyrophosphate synthase; parallel alpha-bet 7e-59
2vg3_A284 Undecaprenyl pyrophosphate synthetase; transferase, cel 5e-58
2d2r_A245 Undecaprenyl pyrophosphate synthase; prenyltransferase; 3e-56
2vg0_A227 Short-chain Z-isoprenyl diphosphate synthetase; peptido 5e-47
>1f75_A Undecaprenyl pyrophosphate synthetase; parallel beta sheet, NEW fold for isoprenoid synthase, peptidoglycan synthesis, transferase; 2.20A {Micrococcus luteus} SCOP: c.101.1.1 Length = 249 Back     alignment and structure
 Score =  283 bits (726), Expect = 2e-77
 Identities = 103/229 (44%), Positives = 147/229 (64%)

Query: 11  PDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRR 70
           P HI IIMDGNGRWA  + +PR  GH +G++   +I   A+++G+K LT++AFS  NW R
Sbjct: 21  PKHIAIIMDGNGRWAKQKKMPRIKGHYEGMQTVRKITRYASDLGVKYLTLYAFSTENWSR 80

Query: 71  PVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGL 130
           P  E++ L+KL   FL      L + N+KV  IG    L D     + EA+++T+ NTGL
Sbjct: 81  PKDEVNYLMKLPGDFLNTFLPELIEKNVKVETIGFIDDLPDHTKKAVLEAKEKTKHNTGL 140

Query: 131 NLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLIIRTGG 190
            L  A NY  R EI  A++ I +  +SG +   ++  +   +YL T+++PDP+L+IRT G
Sbjct: 141 TLVFALNYGGRKEIISAVQLIAERYKSGEISLDEISETHFNEYLFTANMPDPELLIRTSG 200

Query: 191 EKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGL 239
           E+RLS+FL+WQ +YSEFVFI E+WPDF+ E     ++ Y  R RRFGGL
Sbjct: 201 EERLSNFLIWQCSYSEFVFIDEFWPDFNEESLAQCISIYQNRHRRFGGL 249


>1ueh_A Undecaprenyl pyrophosphate synthase; parallel alpha-beta, rossmann-like fold, transferase; HET: OXN; 1.73A {Escherichia coli} SCOP: c.101.1.1 PDB: 1jp3_A* 1v7u_A* 1x06_A* 1x07_A* 2e98_A* 2e99_A* 2e9a_A* 2e9c_A* 2e9d_A* 1x09_A* 1x08_A* Length = 253 Back     alignment and structure
>2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, cell shape, cell division; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A Length = 284 Back     alignment and structure
>2d2r_A Undecaprenyl pyrophosphate synthase; prenyltransferase; 1.88A {Helicobacter pylori} PDB: 2dtn_A Length = 245 Back     alignment and structure
>2vg0_A Short-chain Z-isoprenyl diphosphate synthetase; peptidoglycan synthesis, cell WALL biogenesis/degradation, secreted, cell shape; HET: GPP; 1.7A {Mycobacterium tuberculosis} PDB: 2vfw_A* 2vg1_A* Length = 227 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 undecaprenyl diphosphate synthase [Candidatus Liberibac
2vg3_A284 Undecaprenyl pyrophosphate synthetase; transferase, cel 100.0
1ueh_A253 Undecaprenyl pyrophosphate synthase; parallel alpha-bet 100.0
1f75_A249 Undecaprenyl pyrophosphate synthetase; parallel beta sh 100.0
2d2r_A245 Undecaprenyl pyrophosphate synthase; prenyltransferase, 100.0
2vg0_A227 Short-chain Z-isoprenyl diphosphate synthetase; peptido 100.0
1i60_A278 IOLI protein; beta barrel, structural genomics, PSI, pr 90.27
>2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, cell shape, cell division; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A Back     alignment and structure
Probab=100.00  E-value=0  Score=636.96  Aligned_cols=237  Identities=37%  Similarity=0.706  Sum_probs=232.0

Q ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHH
Q ss_conf             35206898826999848851899975998779899999999999999997698689997202336532301248888988
Q gi|254780775|r    3 ASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLI   82 (243)
Q Consensus         3 ~~~~~~~~P~HIaiImDGNrRwAk~~gl~~~~Gh~~G~~~l~~ii~~~~~~gI~~lTvyafS~eN~~R~~~Ev~~L~~l~   82 (243)
                      ..|.+.++|+|||||||||||||+++|++..+||++|++++.++++||.++||++|||||||+|||+|+++||++||+|+
T Consensus        48 ~~~~~~~lP~HVAiImDGNrRwAk~~gl~~~~GH~~G~~~l~~ii~~~~~~GI~~LTvYaFStEN~~R~~~EV~~L~~L~  127 (284)
T 2vg3_A           48 PRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFN  127 (284)
T ss_dssp             CCCCTTTSCSEEEEECCCHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHTCCEEEEEEEETTGGGSCHHHHHHHHHHH
T ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHCCCCHHHHHHHHHH
T ss_conf             98980018884799644868999877997779999999999999999998699789999752234235648999999999


Q ss_pred             HHHHHHCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             86310000100002832631387445100002358999874202543115897248815789987787643676489687
Q gi|254780775|r   83 KSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCS  162 (243)
Q Consensus        83 ~~~l~~~~~~~~~~~iki~~iGd~~~lp~~i~~~i~~~e~~T~~n~~~~Lnia~~Yggr~EI~~A~k~l~~~~~~~~~~~  162 (243)
                      ..++.+..+.+.+++|++++|||++.||+++++.+.++|+.|++|++++||||++||||+||++|++++++++..+..++
T Consensus       128 ~~~l~~~~~~~~~~~irvr~iGd~~~lp~~l~~~i~~~e~~T~~n~~l~Lniai~YgGR~EIv~A~k~l~~~~~~~~~~~  207 (284)
T 2vg3_A          128 RDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNP  207 (284)
T ss_dssp             HHHHHHHHHHHHHTTEEEEEESCCTTSCHHHHHHHHHHHHHHTTCCSEEEEEEEEECHHHHHHHHHHHHHHHHHTTSSCG
T ss_pred             HHHHHHHHHHHHHHCCCEEECCCCCCCCHHHHHHHHHHEEECCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCH
T ss_conf             99999998888873754131245556866765323201010245654237888424738899999999999876344667


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCEEEECCCCEECCCCCCCHHCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             78115531011336787765269945785213365640113553886368788889899999999986300505884
Q gi|254780775|r  163 HDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGL  239 (243)
Q Consensus       163 ~~I~~~~i~~~L~~~~~p~pDLlIRTsGe~RLSnFllwq~~ysEl~F~~~lWPdf~~~dl~~~i~~y~~r~RrfG~~  239 (243)
                      ++|+++.|+++|+++++||||||||||||+|||||||||++||||||+++|||||+..||.+||.+|++|+|||||-
T Consensus       208 e~i~~~~i~~~L~~~~~pdpDLlIRTsGe~RLSnFLlwQ~ayaEl~F~~~lWPdf~~~dl~~ai~~y~~R~RRfG~a  284 (284)
T 2vg3_A          208 ERITESTIARHLQRPDIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA  284 (284)
T ss_dssp             GGCCHHHHHHHSSSTTCCCCSEEEECTTCCCCTTTTTTTTTTCEEEECCSCGGGCCHHHHHHHHHHHHHSCCCSSCC
T ss_pred             HHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCHHHHCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             67589999975268998898758864786202452102104604896778886599999999999998600657899



>1ueh_A Undecaprenyl pyrophosphate synthase; parallel alpha-beta, rossmann-like fold, transferase; HET: OXN; 1.73A {Escherichia coli} SCOP: c.101.1.1 PDB: 1jp3_A* 1v7u_A* 1x06_A* 1x07_A* 2e98_A* 2e99_A* 2e9a_A* 2e9c_A* 2e9d_A* 1x09_A* 1x08_A* Back     alignment and structure
>1f75_A Undecaprenyl pyrophosphate synthetase; parallel beta sheet, NEW fold for isoprenoid synthase, peptidoglycan synthesis, transferase; 2.20A {Micrococcus luteus} SCOP: c.101.1.1 Back     alignment and structure
>2d2r_A Undecaprenyl pyrophosphate synthase; prenyltransferase, transferase; 1.88A {Helicobacter pylori} PDB: 2dtn_A Back     alignment and structure
>2vg0_A Short-chain Z-isoprenyl diphosphate synthetase; peptidoglycan synthesis, cell WALL biogenesis/degradation, secreted, cell shape; HET: GPP; 1.7A {Mycobacterium tuberculosis} PDB: 2vfw_A* 2vg1_A* Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 243 undecaprenyl diphosphate synthase [Candidatus Liberibac
d1ueha_228 c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Esche 2e-57
d1f75a_229 c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micro 7e-54
d1xr4a1236 c.124.1.2 (A:1-236) Putative citrate lyase alpha chain, 4e-04
>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Undecaprenyl diphosphate synthase
superfamily: Undecaprenyl diphosphate synthase
family: Undecaprenyl diphosphate synthase
domain: Undecaprenyl diphosphate synthase
species: Escherichia coli [TaxId: 562]
 Score =  216 bits (550), Expect = 2e-57
 Identities = 84/228 (36%), Positives = 136/228 (59%)

Query: 6   MSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSI 65
           + +    H+ IIMDGNGRWA  +G  R  GH+ G +     V+ AA  GI+ LT++AFS 
Sbjct: 1   LPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSS 60

Query: 66  NNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTR 125
            NW RP  E+S L++L    L     SL ++N+++R+IG+    +  +   ++++E  T 
Sbjct: 61  ENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTA 120

Query: 126 LNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKYLDTSDVPDPDLI 185
            NTGL L IA NY  R +I + ++ + + ++ G++    +D  ++ +++   ++   DL+
Sbjct: 121 GNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLV 180

Query: 186 IRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRD 233
           IRTGGE R+S+FLLWQ+AY+E  F    WPDF  + F  ALN +  R+
Sbjct: 181 IRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE 228


>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]} Length = 229 Back     information, alignment and structure
>d1xr4a1 c.124.1.2 (A:1-236) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]} Length = 236 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 undecaprenyl diphosphate synthase [Candidatus Liberibac
d1ueha_228 Undecaprenyl diphosphate synthase {Escherichia coli [Ta 100.0
d1f75a_229 Undecaprenyl diphosphate synthase {Micrococcus luteus [ 100.0
>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Undecaprenyl diphosphate synthase
superfamily: Undecaprenyl diphosphate synthase
family: Undecaprenyl diphosphate synthase
domain: Undecaprenyl diphosphate synthase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=619.75  Aligned_cols=228  Identities=37%  Similarity=0.679  Sum_probs=224.9

Q ss_pred             CCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             06898826999848851899975998779899999999999999997698689997202336532301248888988863
Q gi|254780775|r    6 MSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLIKSF   85 (243)
Q Consensus         6 ~~~~~P~HIaiImDGNrRwAk~~gl~~~~Gh~~G~~~l~~ii~~~~~~gI~~lTvyafS~eN~~R~~~Ev~~L~~l~~~~   85 (243)
                      +|+..|+|||||||||||||+++|++..+||++|++++.++++||.++||++|||||||+|||+||++||++||+|+..+
T Consensus         1 ~p~~~P~HiaiImDGNrRwAk~~gl~~~~GH~~G~~~l~~ii~~~~~~gI~~lTvYaFStEN~~R~~~Ev~~Lm~l~~~~   80 (228)
T d1ueha_           1 LPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWA   80 (228)
T ss_dssp             CCTTCCCEEEEECCCHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHTTCSEEEEEEEC--------------CHHHHHH
T ss_pred             CCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             98999989999645878999877997658999999999999999987698689854114542145430267899999999


Q ss_pred             HHHCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             10000100002832631387445100002358999874202543115897248815789987787643676489687781
Q gi|254780775|r   86 LKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDV  165 (243)
Q Consensus        86 l~~~~~~~~~~~iki~~iGd~~~lp~~i~~~i~~~e~~T~~n~~~~Lnia~~Yggr~EI~~A~k~l~~~~~~~~~~~~~I  165 (243)
                      +.+..+.+.+++|+|+||||++.||+++++.+.++|+.|++|++++||||+|||||+||++|++++++++.++.+++++|
T Consensus        81 l~~~~~~~~~~~i~i~~iG~~~~lp~~~~~~i~~~e~~T~~n~~~~Lnia~~Yggr~EI~~A~~~~~~~~~~~~~~~~~i  160 (228)
T d1ueha_          81 LDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQI  160 (228)
T ss_dssp             HHHTHHHHHHTTCEEEEESCCTTSCHHHHHHHHHHHHHHTTCCSCEEEEEESCCHHHHHHHHHHHHHHHHHTTSCCGGGC
T ss_pred             HHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             98768888853579999898632223566666667885268998258998555541279999998889998379987674


Q ss_pred             HHHHHCCCCCCCCCCCCCEEEECCCCEECCCCCCCHHCCCEEEECCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             15531011336787765269945785213365640113553886368788889899999999986300
Q gi|254780775|r  166 DSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRD  233 (243)
Q Consensus       166 ~~~~i~~~L~~~~~p~pDLlIRTsGe~RLSnFllwq~~ysEl~F~~~lWPdf~~~dl~~~i~~y~~r~  233 (243)
                      +++.|.++||++++||||||||||||+|||||||||++||||||+|++||||+..||..||.+|++|+
T Consensus       161 ~~~~~~~~l~~~~~pdpDLlIRTsGe~RLSnFLlWQ~aysEl~F~d~lWPdf~~~dl~~al~~y~~R~  228 (228)
T d1ueha_         161 DEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE  228 (228)
T ss_dssp             CHHHHHTTSTTTTSCCCCEEEECSSCCSCTTSSCGGGTTCEEEECCSCGGGCCHHHHHHHHHHHHTCC
T ss_pred             HHHHEECCCCCCCCCCCCEEEECCCCEECCCCCHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             22202023244799997679963896633563010204525997788887699999999999987569



>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 243 undecaprenyl diphosphate synthase [Candidatus Libe
1ueh_A_253 (A:) Undecaprenyl pyrophosphate synthase; parallel 3e-72
2vg3_A_284 (A:) Undecaprenyl pyrophosphate synthetase; transf 5e-69
1f75_A_249 (A:) Undecaprenyl pyrophosphate synthetase; parall 1e-68
2d2r_A_245 (A:) Undecaprenyl pyrophosphate synthase; prenyltr 4e-67
2vg0_A_227 (A:) Short-chain Z-isoprenyl diphosphate synthetas 7e-60
>1ueh_A (A:) Undecaprenyl pyrophosphate synthase; parallel alpha-beta, rossmann-like fold, transferase; HET: OXN; 1.73A {Escherichia coli}Length = 253 Back     alignment and structure
 Score =  265 bits (679), Expect = 3e-72
 Identities = 92/248 (37%), Positives = 143/248 (57%), Gaps = 11/248 (4%)

Query: 5   MMSSSP-----------PDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEV 53
           MM S+              H+ IIMDGNGRWA  +G  R  GH+ G +     V+ AA  
Sbjct: 1   MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANN 60

Query: 54  GIKNLTIFAFSINNWRRPVSEISELVKLIKSFLKKGFYSLKKNNIKVRVIGNRLSLDDDI 113
           GI+ LT++AFS  NW RP  E+S L++L    L     SL ++N+++R+IG+    +  +
Sbjct: 61  GIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRL 120

Query: 114 LCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCSHDVDSSLIAKY 173
              ++++E  T  NTGL L IA NY  R +I + ++ + + ++ G++    +D  ++ ++
Sbjct: 121 QERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQH 180

Query: 174 LDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRD 233
           +   ++   DL+IRTGGE R+S+FLLWQ+AY+E  F    WPDF  + F  ALN +  R+
Sbjct: 181 VCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE 240

Query: 234 RRFGGLSK 241
           RRFGG   
Sbjct: 241 RRFGGTEP 248


>2vg3_A (A:) Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, cell shape, cell division; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_ALength = 284 Back     alignment and structure
>1f75_A (A:) Undecaprenyl pyrophosphate synthetase; parallel beta sheet, NEW fold for isoprenoid synthase, peptidoglycan synthesis, transferase; 2.20A {Micrococcus luteus}Length = 249 Back     alignment and structure
>2d2r_A (A:) Undecaprenyl pyrophosphate synthase; prenyltransferase; 1.88A {Helicobacter pylori} PDB: 2dtn_ALength = 245 Back     alignment and structure
>2vg0_A (A:) Short-chain Z-isoprenyl diphosphate synthetase; peptidoglycan synthesis, cell WALL biogenesis/degradation, secreted, cell shape; HET: GPP; 1.7A {Mycobacterium tuberculosis} PDB: 2vfw_A* 2vg1_A*Length = 227 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target243 undecaprenyl diphosphate synthase [Candidatus Liberibac
1ueh_A_253 Undecaprenyl pyrophosphate synthase; parallel alph 100.0
2vg3_A_284 Undecaprenyl pyrophosphate synthetase; transferase 100.0
1f75_A_249 Undecaprenyl pyrophosphate synthetase; parallel be 100.0
2d2r_A_245 Undecaprenyl pyrophosphate synthase; prenyltransfe 100.0
2vg0_A_227 Short-chain Z-isoprenyl diphosphate synthetase; pe 100.0
>1ueh_A (A:) Undecaprenyl pyrophosphate synthase; parallel alpha-beta, rossmann-like fold, transferase; HET: OXN; 1.73A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=553.62  Aligned_cols=240  Identities=37%  Similarity=0.682  Sum_probs=235.4

Q ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHH
Q ss_conf             35206898826999848851899975998779899999999999999997698689997202336532301248888988
Q gi|254780775|r    3 ASMMSSSPPDHIGIIMDGNGRWAAARGLPRCAGHRKGIEVFNEIVAAAAEVGIKNLTIFAFSINNWRRPVSEISELVKLI   82 (243)
Q Consensus         3 ~~~~~~~~P~HIaiImDGNrRwAk~~gl~~~~Gh~~G~~~l~~ii~~~~~~gI~~lTvyafS~eN~~R~~~Ev~~L~~l~   82 (243)
                      .....+++|+|||||||||||||+++|++...||+.|++++.+++.||.++||++||+|+||+|||+|+++||+.||+++
T Consensus        10 ~~~~l~kiP~HiavImdgnrR~A~~~g~~~~~gh~~g~~~l~~i~~wc~~~GI~~vsvY~~S~eN~~R~~~ev~~l~~l~   89 (253)
T 1ueh_A           10 SEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELF   89 (253)
T ss_dssp             ---CCTTCCCEEEEECCCHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHTTCSEEEEEEEC--------------CHHH
T ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHH
T ss_conf             01268899988999534878999877997538999999999999999987797289986003631227605677899989


Q ss_pred             HHHHHHCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCH
Q ss_conf             86310000100002832631387445100002358999874202543115897248815789987787643676489687
Q gi|254780775|r   83 KSFLKKGFYSLKKNNIKVRVIGNRLSLDDDILCVLKEAEDQTRLNTGLNLFIAFNYSSRDEISRAIKNIFQDIESGSVCS  162 (243)
Q Consensus        83 ~~~l~~~~~~~~~~~iki~~iGd~~~lp~~i~~~i~~~e~~T~~n~~~~Lnia~~Yggr~EI~~A~k~l~~~~~~~~~~~  162 (243)
                      ...+.+......+++++++++|+++.+|+++++.+.++++.|+++++++||+|++||||+||++|+++++++++.+.+++
T Consensus        90 ~~~~~~~~~~~~~~~~~i~~~G~~~~lp~~~~~~~~~~~~~t~~~~~~~vni~~~y~Gr~eIv~a~k~l~~~~~~~~~~~  169 (253)
T 1ueh_A           90 VWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQP  169 (253)
T ss_dssp             HHHHHHTHHHHHHTTCEEEEESCCTTSCHHHHHHHHHHHHHHTTCCSCEEEEEESCCHHHHHHHHHHHHHHHHHTTSCCG
T ss_pred             HHHHHHHHHHHHHHCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCH
T ss_conf             99998888988761557998378313213556555567875268998259997455430689999999879998279897


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCEEEECCCCEECCCCCCCHHCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             78115531011336787765269945785213365640113553886368788889899999999986300505884656
Q gi|254780775|r  163 HDVDSSLIAKYLDTSDVPDPDLIIRTGGEKRLSDFLLWQVAYSEFVFIPEYWPDFSRELFFHALNQYNLRDRRFGGLSKK  242 (243)
Q Consensus       163 ~~I~~~~i~~~L~~~~~p~pDLlIRTsGe~RLSnFllwq~~ysEl~F~~~lWPdf~~~dl~~~i~~y~~r~RrfG~~~~~  242 (243)
                      ++|++++++++|++++.|||||+|||||++|||||||||++||||||++++||||++.||.+||.+|++|+|||||++++
T Consensus       170 ~~i~~~~i~~~L~~~~~PdpDLlIrtgg~~rLs~Fl~WQ~~~tEi~f~~~~wp~~~~~~f~~~l~~y~~~~~R~Gk~~~~  249 (253)
T 1ueh_A          170 DQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPG  249 (253)
T ss_dssp             GGCCHHHHHTTSTTTTSCCCCEEEECSSCCSCTTSSCGGGTTCEEEECCSCGGGCCHHHHHHHHHHHHTCC---------
T ss_pred             HHHHHHHHCCCCCCCCCCCCCEEEECCCCEECCCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             77410120001134677787569854894561466311314434897788986699999999999997524758999987



>2vg3_A (A:) Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, cell shape, cell division; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A Back     alignment and structure
>1f75_A (A:) Undecaprenyl pyrophosphate synthetase; parallel beta sheet, NEW fold for isoprenoid synthase, peptidoglycan synthesis, transferase; 2.20A {Micrococcus luteus} Back     alignment and structure
>2d2r_A (A:) Undecaprenyl pyrophosphate synthase; prenyltransferase; 1.88A {Helicobacter pylori} PDB: 2dtn_A Back     alignment and structure
>2vg0_A (A:) Short-chain Z-isoprenyl diphosphate synthetase; peptidoglycan synthesis, cell WALL biogenesis/degradation, secreted, cell shape; HET: GPP; 1.7A {Mycobacterium tuberculosis} PDB: 2vfw_A* 2vg1_A* Back     alignment and structure