254780776

254780776

ribosome recycling factor

GeneID in NCBI database:8209782Locus tag:CLIBASIA_03335
Protein GI in NCBI database:254780776Protein Accession:YP_003065189.1
Gene range:+(486103, 486663)Protein Length:186aa
Gene description:ribosome recycling factor
COG prediction:[J] Ribosome recycling factor
KEGG prediction:frr; ribosome recycling factor; K02838 ribosome recycling factor
SEED prediction:Ribosome recycling factor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation termination factors bacterial;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF
ccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccEEEEEccccccHHHcEEEEcccccEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcccEEEEccEEEEHHHcEEEEEEEccEEEEEEcccccHHHHHHHHHHcccccccEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MNQVIDLQNIKDRMGDTISFLKKDMMtlrtgrvspsmldLVKVEaygshvplnqvanvtvlEPRMLVVSVWDKEMVASVERGihesnlglnpivegqvlripvpettEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF
mnqvidlqnikdrmgDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGShvplnqvanvtvlEPRMLVVSVWDKEMVASVERGihesnlglnpivegqvlRIPVPETTEERRLALVKVAhayaekskisvrnirrdgmdhlkksrksgkasEDMVASLENDiqkitdstiKNIDSFFEEKKKEIMHF
MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF
**********KDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKS************SLENDIQKITDSTIKNIDSFFEEKKKEIMHF
MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDH**************VASLENDIQKITDSTIKNIDSFFEEKKKEIMHF
MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF
MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF
MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target186 ribosome recycling factor [Candidatus Liberibacter asia
315121993186 ribosome recycling factor [Candidatus Liberibacter sola 1 4e-82
86357537186 ribosome recycling factor [Rhizobium etli CFN 42] Lengt 1 3e-59
116251980186 ribosome recycling factor [Rhizobium leguminosarum bv. 1 2e-58
209549185186 ribosome recycling factor [Rhizobium leguminosarum bv. 1 3e-58
222085860186 ribosome recycling factor [Agrobacterium radiobacter K8 1 3e-58
218679110186 ribosome recycling factor [Rhizobium etli CIAT 894] Len 1 8e-58
222148859186 ribosome recycling factor [Agrobacterium vitis S4] Leng 1 3e-57
15965251186 ribosome recycling factor [Sinorhizobium meliloti 1021] 1 2e-56
150396353186 ribosome recycling factor [Sinorhizobium medicae WSM419 1 2e-56
325292740185 Ribosome recycling factor [Agrobacterium sp. H13-3] Len 1 2e-56
>gi|315121993|ref|YP_004062482.1| ribosome recycling factor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 186 Back     alignment and organism information
 Score =  307 bits (786), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 171/186 (91%)

Query: 1   MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTV 60
           MNQ IDL++IKDRM D ISFLKKDMMTLRTGRVS SMLDLVKV++YGS VPLNQVANVTV
Sbjct: 1   MNQAIDLKSIKDRMNDAISFLKKDMMTLRTGRVSTSMLDLVKVDSYGSRVPLNQVANVTV 60

Query: 61  LEPRMLVVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHA 120
           L+PR L VSVWD  MV+SVERGIH+SNLG NPIVEGQVLRIPVPETTEERRLALVKVAH 
Sbjct: 61  LDPRTLAVSVWDSSMVSSVERGIHDSNLGFNPIVEGQVLRIPVPETTEERRLALVKVAHN 120

Query: 121 YAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKK 180
           YAEKSKISVRNIRRDGMD+LKKS+KSGK SED+  SLEND+QK+TD+TIK+IDSFFEEKK
Sbjct: 121 YAEKSKISVRNIRRDGMDYLKKSKKSGKISEDIAESLENDVQKMTDATIKDIDSFFEEKK 180

Query: 181 KEIMHF 186
           KEIM F
Sbjct: 181 KEIMRF 186


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357537|ref|YP_469429.1| ribosome recycling factor [Rhizobium etli CFN 42] Length = 186 Back     alignment and organism information
>gi|116251980|ref|YP_767818.1| ribosome recycling factor [Rhizobium leguminosarum bv. viciae 3841] Length = 186 Back     alignment and organism information
>gi|209549185|ref|YP_002281102.1| ribosome recycling factor [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 186 Back     alignment and organism information
>gi|222085860|ref|YP_002544391.1| ribosome recycling factor [Agrobacterium radiobacter K84] Length = 186 Back     alignment and organism information
>gi|218679110|ref|ZP_03527007.1| ribosome recycling factor [Rhizobium etli CIAT 894] Length = 186 Back     alignment and organism information
>gi|222148859|ref|YP_002549816.1| ribosome recycling factor [Agrobacterium vitis S4] Length = 186 Back     alignment and organism information
>gi|15965251|ref|NP_385604.1| ribosome recycling factor [Sinorhizobium meliloti 1021] Length = 186 Back     alignment and organism information
>gi|150396353|ref|YP_001326820.1| ribosome recycling factor [Sinorhizobium medicae WSM419] Length = 186 Back     alignment and organism information
>gi|325292740|ref|YP_004278604.1| Ribosome recycling factor [Agrobacterium sp. H13-3] Length = 185 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target186 ribosome recycling factor [Candidatus Liberibacter asia
PRK00083185 PRK00083, frr, ribosome recycling factor; Reviewed 3e-70
COG0233187 COG0233, Frr, Ribosome recycling factor [Translation, r 8e-57
cd00520179 cd00520, RRF, Ribosome recycling factor (RRF) 2e-48
TIGR00496176 TIGR00496, frr, ribosome recycling factor 9e-47
KOG4759263 KOG4759, KOG4759, KOG4759, Ribosome recycling factor [T 3e-29
pfam01765165 pfam01765, RRF, Ribosome recycling factor 8e-61
>gnl|CDD|178850 PRK00083, frr, ribosome recycling factor; Reviewed Back     alignment and domain information
>gnl|CDD|30582 COG0233, Frr, Ribosome recycling factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29621 cd00520, RRF, Ribosome recycling factor (RRF) Back     alignment and domain information
>gnl|CDD|129587 TIGR00496, frr, ribosome recycling factor Back     alignment and domain information
>gnl|CDD|39956 KOG4759, KOG4759, KOG4759, Ribosome recycling factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145100 pfam01765, RRF, Ribosome recycling factor Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 186 ribosome recycling factor [Candidatus Liberibacter asia
TIGR00496177 frr ribosome recycling factor; InterPro: IPR002661 The 100.0
COG0233187 Frr Ribosome recycling factor [Translation, ribosomal s 100.0
PRK00083185 frr ribosome recycling factor; Reviewed 100.0
cd00520179 RRF Ribosome recycling factor (RRF). Ribosome recycling 100.0
pfam01765165 RRF Ribosome recycling factor. The ribosome recycling f 100.0
KOG4759263 consensus 100.0
>TIGR00496 frr ribosome recycling factor; InterPro: IPR002661 The ribosome recycling factor or ribosome release factor (RRF) dissociates ribosomes from mRNA after termination of translation, and is essential for bacterial growth Back     alignment and domain information
>COG0233 Frr Ribosome recycling factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00083 frr ribosome recycling factor; Reviewed Back     alignment and domain information
>cd00520 RRF Ribosome recycling factor (RRF) Back     alignment and domain information
>pfam01765 RRF Ribosome recycling factor Back     alignment and domain information
>KOG4759 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target186 ribosome recycling factor [Candidatus Liberibacter asia
1ek8_A185 Crystal Structure Of The Ribosome Recycling Factor 1e-48
1ise_A185 Crystal Structure Of A Mutant Of Ribosome Recycling 1e-47
1is1_A185 Crystal Structure Of Ribosome Recycling Factor From 3e-46
1eh1_A185 Ribosome Recycling Factor From Thermus Thermophilus 3e-45
1wqf_A185 Crystal Structure Of Ribosome Recycling Factor From 6e-43
1dd5_A185 Crystal Structure Of Thermotoga Maritima Ribosome R 6e-41
1ge9_A184 Solution Structure Of The Ribosome Recycling Factor 2e-31
1y69_8113 Rrf Domain I In Complex With The 50s Ribosomal Subu 4e-16
3lf9_A121 Crystal Structure Of Hiv Epitope-Scaffold 4e10_d0_1 3e-10
3lhp_S123 Crystal Structure Of Hiv Epitope-Scaffold 4e10_d0_1 3e-06
1wih_A84 Solution Structure Of Rsgi Ruh-021, A Domain Ii Of 3e-04
gi|13399451|pdb|1EK8|A Chain A, Crystal Structure Of The Ribosome Recycling Factor (Rrf) From Escherichia Coli Length = 185 Back     alignment and structure
 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 74/179 (41%), Positives = 115/179 (64%)

Query: 8   QNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLV 67
           ++ + RM   +   K  +  +RTGR SPS+LD + VE YG+  PL Q+A+VTV + R L 
Sbjct: 7   KDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLK 66

Query: 68  VSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKI 127
           ++V+D+ M  +VE+ I  S+LGLNP   G  +R+P+P  TEERR  L K+    AE++++
Sbjct: 67  INVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARV 126

Query: 128 SVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF 186
           +VRN+RRD  D +K   K  + SED     ++D+QK+TD+ IK I++   +K+ E+M F
Sbjct: 127 AVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF 185


>gi|37926485|pdb|1ISE|A Chain A, Crystal Structure Of A Mutant Of Ribosome Recycling Factor From Escherichia Coli, Arg132gly Length = 185 Back     alignment and structure
gi|33357058|pdb|1IS1|A Chain A, Crystal Structure Of Ribosome Recycling Factor From Vibrio Parahaemolyticus Length = 185 Back     alignment and structure
gi|11513707|pdb|1EH1|A Chain A, Ribosome Recycling Factor From Thermus Thermophilus Length = 185 Back     alignment and structure
gi|61680226|pdb|1WQF|A Chain A, Crystal Structure Of Ribosome Recycling Factor From Mycobacterium Tuberculosis Length = 185 Back     alignment and structure
gi|6730315|pdb|1DD5|A Chain A, Crystal Structure Of Thermotoga Maritima Ribosome Recycling Factor, Rrf Length = 185 Back     alignment and structure
gi|14277735|pdb|1GE9|A Chain A, Solution Structure Of The Ribosome Recycling Factor Length = 184 Back     alignment and structure
>gi|61680523|pdb|1Y69|8 Chain 8, Rrf Domain I In Complex With The 50s Ribosomal Subunit From Deinococcus Radiodurans Length = 113 Back     alignment and structure
>gi|307568226|pdb|3LF9|A Chain A, Crystal Structure Of Hiv Epitope-Scaffold 4e10_d0_1is1a_001_c Length = 121 Back     alignment and structure
>gi|307568248|pdb|3LHP|S Chain S, Crystal Structure Of Hiv Epitope-Scaffold 4e10_d0_1isea_004_n 4e10 Fv Complex Length = 123 Back     alignment and structure
>gi|159163384|pdb|1WIH|A Chain A, Solution Structure Of Rsgi Ruh-021, A Domain Ii Of Ribosome Recycling Factor From Mouse Cdna Length = 84 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target186 ribosome recycling factor [Candidatus Liberibacter asia
1eh1_A185 Ribosome recycling factor; translation, hinge variabili 4e-57
1is1_A185 Ribosome recycling factor; translation; 2.20A {Vibrio p 6e-51
1ise_A185 Ribosome recycling factor; translation; 2.20A {Escheric 3e-50
1ge9_A184 Ribosome recycling factor; three-helix bundle; NMR {Aqu 2e-43
1wqg_A185 Ribosome recycling factor; translation factor, triple-h 8e-42
1dd5_A185 Ribosome recycling factor; three-helix bundle, beta-alp 1e-39
3lhp_S123 4E10_D0_1ISEA_004_N (T93); epitope-scaffold, immune sys 5e-30
1y69_8113 Ribosome recycling factor; RRF; 3.33A {Deinococcus radi 9e-26
3lf9_A121 4E10_D0_1IS1A_001_C (T161); epitope-scaffold, immune sy 2e-24
1wih_A84 Mitochondrial ribosome recycling factor; structural gen 1e-21
>1eh1_A Ribosome recycling factor; translation, hinge variability; 2.60A {Thermus thermophilus} SCOP: d.67.3.1 PDB: 2qbe_6 2qbg_6 2qbi_6* 2qbk_6* 2v46_Y* 2v48_Y* 2z4l_6* 2z4n_6* Length = 185 Back     alignment and structure
 Score =  215 bits (550), Expect = 4e-57
 Identities = 78/178 (43%), Positives = 113/178 (63%)

Query: 7   LQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRML 66
               +  M  ++  L+ ++  LRTGR +P++L  +KVE YG+HVPLNQ+A VT  +PR L
Sbjct: 7   YAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTL 66

Query: 67  VVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSK 126
           VV  WD+  + ++E+ I +S+LGLNP  +G  L I +P  TEERR  LV+    YAE+ +
Sbjct: 67  VVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGR 126

Query: 127 ISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIM 184
           +++RNIRR+ +D LKK  K    SED     E +IQKITD  I   D   E+K++EI+
Sbjct: 127 VAIRNIRREALDKLKKLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEIL 184


>1is1_A Ribosome recycling factor; translation; 2.20A {Vibrio parahaemolyticus} SCOP: d.67.3.1 Length = 185 Back     alignment and structure
>1ise_A Ribosome recycling factor; translation; 2.20A {Escherichia coli} SCOP: d.67.3.1 PDB: 1ek8_A* 1zn0_A 1zn1_A 2rdo_8 Length = 185 Back     alignment and structure
>1ge9_A Ribosome recycling factor; three-helix bundle; NMR {Aquifex aeolicus} SCOP: d.67.3.1 Length = 184 Back     alignment and structure
>1wqg_A Ribosome recycling factor; translation factor, triple-helix bundle, protein synthesis; 2.15A {Mycobacterium tuberculosis} SCOP: d.67.3.1 PDB: 1wqf_A 1wqh_A Length = 185 Back     alignment and structure
>1dd5_A Ribosome recycling factor; three-helix bundle, beta-alpha-beta sandwich; 2.55A {Thermotoga maritima} SCOP: d.67.3.1 PDB: 1t1m_C Length = 185 Back     alignment and structure
>3lhp_S 4E10_D0_1ISEA_004_N (T93); epitope-scaffold, immune system; 2.70A {Artificial gene} PDB: 1y69_8 Length = 123 Back     alignment and structure
>1y69_8 Ribosome recycling factor; RRF; 3.33A {Deinococcus radiodurans} Length = 113 Back     alignment and structure
>3lf9_A 4E10_D0_1IS1A_001_C (T161); epitope-scaffold, immune system; 2.00A {Artificial gene} Length = 121 Back     alignment and structure
>1wih_A Mitochondrial ribosome recycling factor; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.67.3.1 Length = 84 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target186 ribosome recycling factor [Candidatus Liberibacter asia
1ise_A185 Ribosome recycling factor; translation; 2.20A {Escheric 100.0
1dd5_A185 Ribosome recycling factor; three-helix bundle, beta-alp 100.0
1is1_A185 Ribosome recycling factor; translation; 2.20A {Vibrio p 100.0
1wqg_A185 Ribosome recycling factor; translation factor, triple-h 100.0
1eh1_A185 Ribosome recycling factor; translation, hinge variabili 100.0
1ge9_A184 Ribosome recycling factor; three-helix bundle; NMR {Aqu 100.0
3lhp_S123 4E10_D0_1ISEA_004_N (T93); epitope-scaffold, immune sys 99.96
3lf9_A121 4E10_D0_1IS1A_001_C (T161); epitope-scaffold, immune sy 99.91
1wih_A84 Mitochondrial ribosome recycling factor; structural gen 99.9
>1ise_A Ribosome recycling factor; translation; 2.20A {Escherichia coli} SCOP: d.67.3.1 PDB: 1ek8_A* 1zn0_A 1zn1_A 2rdo_8 Back     alignment and structure
Probab=100.00  E-value=0  Score=403.12  Aligned_cols=184  Identities=40%  Similarity=0.647  Sum_probs=180.6

Q ss_pred             CCHHHCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHH
Q ss_conf             94200789999999999999999975313888896782450788558642399876512057838989965967899999
Q gi|254780776|r    1 MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVE   80 (186)
Q Consensus         1 ~~e~~dl~~~~~~m~~~i~~l~~el~~irtGrasp~lld~i~V~~~g~~~pL~~lA~Is~~~~~~l~I~~~D~~~ik~I~   80 (186)
                      |+++  +.+++++|++++++|+.+|+++|+||+||++||+|+|+|||+++||++||+||+++|++|+|+|||++++++|+
T Consensus         2 i~~i--~~~~~~kM~~~v~~l~~el~~irtGrasp~ild~I~V~~~g~~~pL~~lA~Is~~~~~~l~I~~~D~~~~~~I~   79 (185)
T 1ise_A            2 ISDI--RKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVE   79 (185)
T ss_dssp             CHHH--HHHHHHHHHHHHHHHHHHHTTSCCSSCCGGGGTTCEEEETTEEEEGGGTEEEEEEETTEEEEEESSGGGHHHHH
T ss_pred             HHHH--HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCEEEEECCCCCCHHHHHEEEECCCCEEEEEECCHHHHHHHH
T ss_conf             4899--99999999999999999998773189997997934887799966488820346179865899737254499999


Q ss_pred             HHHHCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             99631788998454773478861555689999999999998889999999999999999998753589997899888999
Q gi|254780776|r   81 RGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLEND  160 (186)
Q Consensus        81 kAI~~s~l~l~p~~dg~~I~i~iP~lT~E~R~~lvK~~k~~~E~~K~~iR~iR~~~~~~ikk~~k~~~iseD~~~~~~~~  160 (186)
                      +||++||||+||+++|++|+|||||||+|+|++++|.||+.+|+||++||++|+++++++|+++|.+++|||+.++++++
T Consensus        80 kAI~~s~l~l~p~~dg~~irv~iP~~T~E~R~~l~K~~k~~~E~aK~~iR~iR~~~~~~ik~~~k~~~iseD~~k~~~~~  159 (185)
T 1ise_A           80 KAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVGRDANDKVKALLKDKEISEDDDRRSQDD  159 (185)
T ss_dssp             HHHHTTCTTCCCEESSSEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSCHHHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             99986899999875887356259966799999999999999999999999999999999987532489886588889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999999999999887449
Q gi|254780776|r  161 IQKITDSTIKNIDSFFEEKKKEIMHF  186 (186)
Q Consensus       161 iq~lt~~~~~~id~~~~~Kekell~~  186 (186)
                      ||++||+|++++|++++.||+|||+|
T Consensus       160 iq~ltd~~~~~id~~~~~KekEll~~  185 (185)
T 1ise_A          160 VQKLTDAAIKKIEAALADKEAELMQF  185 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999997379



>1dd5_A Ribosome recycling factor; three-helix bundle, beta-alpha-beta sandwich; 2.55A {Thermotoga maritima} SCOP: d.67.3.1 PDB: 1t1m_C Back     alignment and structure
>1is1_A Ribosome recycling factor; translation; 2.20A {Vibrio parahaemolyticus} SCOP: d.67.3.1 Back     alignment and structure
>1wqg_A Ribosome recycling factor; translation factor, triple-helix bundle, protein synthesis; 2.15A {Mycobacterium tuberculosis} SCOP: d.67.3.1 PDB: 1wqf_A 1wqh_A Back     alignment and structure
>1eh1_A Ribosome recycling factor; translation, hinge variability; 2.60A {Thermus thermophilus} SCOP: d.67.3.1 PDB: 2qbe_6 2qbg_6 2qbi_6* 2qbk_6* 2v46_Y* 2v48_Y* 2z4l_6* 2z4n_6* Back     alignment and structure
>1ge9_A Ribosome recycling factor; three-helix bundle; NMR {Aquifex aeolicus} SCOP: d.67.3.1 Back     alignment and structure
>3lhp_S 4E10_D0_1ISEA_004_N (T93); epitope-scaffold, immune system; 2.70A {Artificial gene} PDB: 1y69_8 Back     alignment and structure
>3lf9_A 4E10_D0_1IS1A_001_C (T161); epitope-scaffold, immune system; 2.00A {Artificial gene} Back     alignment and structure
>1wih_A Mitochondrial ribosome recycling factor; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.67.3.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 186 ribosome recycling factor [Candidatus Liberibacter asia
d1wqga1183 d.67.3.1 (A:2-184) Ribosome recycling factor, RRF {Myco 1e-42
d1eh1a_185 d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus t 2e-41
d1is1a_185 d.67.3.1 (A:) Ribosome recycling factor, RRF {Vibrio pa 6e-41
d1dd5a_184 d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotog 7e-41
d1ek8a_185 d.67.3.1 (A:) Ribosome recycling factor, RRF {Escherich 2e-39
d1ge9a_184 d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex a 4e-37
d1wiha_84 d.67.3.1 (A:) Ribosome recycling factor, RRF {Mouse (Mu 1e-22
>d1wqga1 d.67.3.1 (A:2-184) Ribosome recycling factor, RRF {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: RRF/tRNA synthetase additional domain-like
superfamily: Ribosome recycling factor, RRF
family: Ribosome recycling factor, RRF
domain: Ribosome recycling factor, RRF
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  166 bits (422), Expect = 1e-42
 Identities = 65/178 (36%), Positives = 110/178 (61%)

Query: 7   LQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRML 66
           L + +++M   ++  + D+ T+RTGR +P M   + ++ YG+  P+ Q+A++ V E R++
Sbjct: 5   LFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLV 64

Query: 67  VVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSK 126
           V+  ++   + ++E  I  S+LG+NP  +G ++R+ VP+ TEERR  LVK A    E++K
Sbjct: 65  VIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAK 124

Query: 127 ISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIM 184
           +SVRNIRR  M+ L + RK G+A ED V   E D+ K T   +  ID   + K+ E++
Sbjct: 125 VSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELL 182


>d1eh1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} Length = 185 Back     information, alignment and structure
>d1is1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Vibrio parahaemolyticus [TaxId: 670]} Length = 185 Back     information, alignment and structure
>d1dd5a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1ek8a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]} Length = 185 Back     information, alignment and structure
>d1ge9a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex aeolicus [TaxId: 63363]} Length = 184 Back     information, alignment and structure
>d1wiha_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Length = 84 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target186 ribosome recycling factor [Candidatus Liberibacter asia
d1dd5a_184 Ribosome recycling factor, RRF {Thermotoga maritima [Ta 100.0
d1ek8a_185 Ribosome recycling factor, RRF {Escherichia coli [TaxId 100.0
d1wqga1183 Ribosome recycling factor, RRF {Mycobacterium tuberculo 100.0
d1is1a_185 Ribosome recycling factor, RRF {Vibrio parahaemolyticus 100.0
d1eh1a_185 Ribosome recycling factor, RRF {Thermus thermophilus [T 100.0
d1ge9a_184 Ribosome recycling factor, RRF {Aquifex aeolicus [TaxId 100.0
d1wiha_84 Ribosome recycling factor, RRF {Mouse (Mus musculus), m 99.9
>d1dd5a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: RRF/tRNA synthetase additional domain-like
superfamily: Ribosome recycling factor, RRF
family: Ribosome recycling factor, RRF
domain: Ribosome recycling factor, RRF
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=0  Score=406.68  Aligned_cols=184  Identities=41%  Similarity=0.709  Sum_probs=181.1

Q ss_pred             CCHHHCHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHH
Q ss_conf             94200789999999999999999975313888896782450788558642399876512057838989965967899999
Q gi|254780776|r    1 MNQVIDLQNIKDRMGDTISFLKKDMMTLRTGRVSPSMLDLVKVEAYGSHVPLNQVANVTVLEPRMLVVSVWDKEMVASVE   80 (186)
Q Consensus         1 ~~e~~dl~~~~~~m~~~i~~l~~el~~irtGrasp~lld~i~V~~~g~~~pL~~lA~Is~~~~~~l~I~~~D~~~ik~I~   80 (186)
                      +|++  +.+++++|+++++||+.+|+++|||||||++||+|+|+|||+++||++||+|++++|++|+|+|||++++++|+
T Consensus         1 i~~~--~~~~~~kM~~ai~~l~~el~~irtGra~p~lld~I~V~~yg~~~pL~~lA~Is~~~~~~l~I~p~D~~~v~~I~   78 (184)
T d1dd5a_           1 VNPF--IKEAKEKMKRTLEKIEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISISEERTLVIKPWDKSVLSLIE   78 (184)
T ss_dssp             CCHH--HHHHHHHHHHHHHHHHHHHHHSCCSSCCGGGGTTCEEEETTEEEEGGGSEEEEECSTTEEEEEESSTTHHHHHH
T ss_pred             CHHH--HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCEEEEECCCCCCHHHHHHHCCCCCCEEEEECCCHHHHHHHH
T ss_conf             9579--99999999999999999998874289997997844784489865278886202478634675046343589999


Q ss_pred             HHHHCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             99631788998454773478861555689999999999998889999999999999999998753589997899888999
Q gi|254780776|r   81 RGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKSGKASEDMVASLEND  160 (186)
Q Consensus        81 kAI~~s~l~l~p~~dg~~I~i~iP~lT~E~R~~lvK~~k~~~E~~K~~iR~iR~~~~~~ikk~~k~~~iseD~~~~~~~~  160 (186)
                      +||++||||+||++||+.|+|||||||+|+|++++|.||+.+|+||++||++|+++++++|++++.+++|||+.++++++
T Consensus        79 kAI~~s~lglnp~~dg~~Iri~iP~lT~E~R~elvK~~k~~~E~aKv~iR~iR~~~~~~lk~~~k~~~iseD~~k~~~~~  158 (184)
T d1dd5a_          79 KAINASDLGLNPINDGNVIRLVFPSPTTEQREKWVKKAKEIVEEGKIAIRNIRREILKKIKEDQKEGLIPEDDAKRLENE  158 (184)
T ss_dssp             HHHHHSSSCCCCEECSSCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSCHHHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             99985156789866764211124641399999999999999999999999999999999887530489886588889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999999999999999887449
Q gi|254780776|r  161 IQKITDSTIKNIDSFFEEKKKEIMHF  186 (186)
Q Consensus       161 iq~lt~~~~~~id~~~~~Kekell~~  186 (186)
                      ||++||+|++++|++++.||+|||+|
T Consensus       159 iq~ltd~~~~~id~~~~~Kekeim~~  184 (184)
T d1dd5a_         159 IQKLTDEFIEKLDEVFEIKKEEIMEF  184 (184)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999997379



>d1ek8a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wqga1 d.67.3.1 (A:2-184) Ribosome recycling factor, RRF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1is1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1eh1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ge9a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wiha_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial [TaxId: 10090]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 186 ribosome recycling factor [Candidatus Liberibacter
1y69_8_113 (8:) Ribosome recycling factor; RRF; 3.33A {Deinoc 1e-30
1wih_A_84 (A:) Mitochondrial ribosome recycling factor; stru 3e-28
1wqg_A_33-10472 (A:33-104) Ribosome recycling factor; translation 2e-25
1dd5_A_34-10471 (A:34-104) Ribosome recycling factor; three-helix 2e-25
1ise_A_33-10472 (A:33-104) Ribosome recycling factor; translation; 5e-25
1is1_A_33-10472 (A:33-104) Ribosome recycling factor; translation; 1e-24
1eh1_A_36-10570 (A:36-105) Ribosome recycling factor; translation, 8e-24
1ge9_A_37-10670 (A:37-106) Ribosome recycling factor; three-helix 4e-23
1eh1_A_1-35_106-185115 (A:1-35,A:106-185) Ribosome recycling factor; tran 5e-23
1ise_A_1-32_105-185113 (A:1-32,A:105-185) Ribosome recycling factor; tran 8e-23
1wqg_A_1-32_105-185113 (A:1-32,A:105-185) Ribosome recycling factor; tran 1e-22
1is1_A_1-32_105-185113 (A:1-32,A:105-185) Ribosome recycling factor; tran 1e-22
1dd5_A_1-33_105-185114 (A:1-33,A:105-185) Ribosome recycling factor; thre 2e-22
1ge9_A_1-36_107-184114 (A:1-36,A:107-184) Ribosome recycling factor; thre 3e-20
>1y69_8 (8:) Ribosome recycling factor; RRF; 3.33A {Deinococcus radiodurans}Length = 113 Back     alignment and structure
 Score =  126 bits (319), Expect = 1e-30
 Identities = 37/120 (30%), Positives = 65/120 (54%), Gaps = 7/120 (5%)

Query: 67  VVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSK 126
           ++S   K+    +++ +      ++ I  G          TEERR  L K+    AE+++
Sbjct: 1   MISDIRKDAEVRMDKCVEAFKTQISKIRTG-------GGGTEERRKDLTKIVRGEAEQAR 53

Query: 127 ISVRNIRRDGMDHLKKSRKSGKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF 186
           ++VRN+RRD  D +K   K  + SED     ++D+QK+TD+ IK I++   +K+ E+M F
Sbjct: 54  VAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF 113


>1wih_A (A:) Mitochondrial ribosome recycling factor; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus}Length = 84 Back     alignment and structure
>1wqg_A (A:33-104) Ribosome recycling factor; translation factor, triple-helix bundle, protein synthesis; 2.15A {Mycobacterium tuberculosis}Length = 72 Back     alignment and structure
>1dd5_A (A:34-104) Ribosome recycling factor; three-helix bundle, beta-alpha-beta sandwich; 2.55A {Thermotoga maritima}Length = 71 Back     alignment and structure
>1ise_A (A:33-104) Ribosome recycling factor; translation; 2.20A {Escherichia coli}Length = 72 Back     alignment and structure
>1is1_A (A:33-104) Ribosome recycling factor; translation; 2.20A {Vibrio parahaemolyticus}Length = 72 Back     alignment and structure
>1eh1_A (A:36-105) Ribosome recycling factor; translation, hinge variability; 2.60A {Thermus thermophilus}Length = 70 Back     alignment and structure
>1ge9_A (A:37-106) Ribosome recycling factor; three-helix bundle; NMR {Aquifex aeolicus}Length = 70 Back     alignment and structure
>1eh1_A (A:1-35,A:106-185) Ribosome recycling factor; translation, hinge variability; 2.60A {Thermus thermophilus}Length = 115 Back     alignment and structure
>1ise_A (A:1-32,A:105-185) Ribosome recycling factor; translation; 2.20A {Escherichia coli}Length = 113 Back     alignment and structure
>1wqg_A (A:1-32,A:105-185) Ribosome recycling factor; translation factor, triple-helix bundle, protein synthesis; 2.15A {Mycobacterium tuberculosis}Length = 113 Back     alignment and structure
>1is1_A (A:1-32,A:105-185) Ribosome recycling factor; translation; 2.20A {Vibrio parahaemolyticus}Length = 113 Back     alignment and structure
>1dd5_A (A:1-33,A:105-185) Ribosome recycling factor; three-helix bundle, beta-alpha-beta sandwich; 2.55A {Thermotoga maritima}Length = 114 Back     alignment and structure
>1ge9_A (A:1-36,A:107-184) Ribosome recycling factor; three-helix bundle; NMR {Aquifex aeolicus}Length = 114 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target186 ribosome recycling factor [Candidatus Liberibacter asia
1y69_8_113 Ribosome recycling factor; RRF; 3.33A {Deinococcus 99.96
1wih_A_84 Mitochondrial ribosome recycling factor; structura 99.92
1ise_A_33-10472 Ribosome recycling factor; translation; 2.20A {Esc 99.84
1wqg_A_33-10472 Ribosome recycling factor; translation factor, tri 99.84
1is1_A_33-10472 Ribosome recycling factor; translation; 2.20A {Vib 99.83
1dd5_A_34-10471 Ribosome recycling factor; three-helix bundle, bet 99.82
1eh1_A_36-10570 Ribosome recycling factor; translation, hinge vari 99.82
1ge9_A_37-10670 Ribosome recycling factor; three-helix bundle; NMR 99.76
1ise_A_1-32_105-185113 Ribosome recycling factor; translation; 2.20A {Esc 99.9
1is1_A_1-32_105-185113 Ribosome recycling factor; translation; 2.20A {Vib 99.9
1eh1_A_1-35_106-185115 Ribosome recycling factor; translation, hinge vari 99.89
1wqg_A_1-32_105-185113 Ribosome recycling factor; translation factor, tri 99.87
1ge9_A_1-36_107-184114 Ribosome recycling factor; three-helix bundle; NMR 99.84
1dd5_A_1-33_105-185114 Ribosome recycling factor; three-helix bundle, bet 99.84
>1y69_8 (8:) Ribosome recycling factor; RRF; 3.33A {Deinococcus radiodurans} Back     alignment and structure
Probab=99.96  E-value=3.1e-30  Score=227.95  Aligned_cols=113  Identities=32%  Similarity=0.464  Sum_probs=109.7

Q ss_pred             EEEECCHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             89965967899999996317889984547734788615556899999999999988899999999999999999987535
Q gi|254780776|r   67 VVSVWDKEMVASVERGIHESNLGLNPIVEGQVLRIPVPETTEERRLALVKVAHAYAEKSKISVRNIRRDGMDHLKKSRKS  146 (186)
Q Consensus        67 ~I~~~D~~~ik~I~kAI~~s~l~l~p~~dg~~I~i~iP~lT~E~R~~lvK~~k~~~E~~K~~iR~iR~~~~~~ikk~~k~  146 (186)
                      +|+||||+++++|++||++||||+||++       ++|+||+|+|++++|.|++.+|+||++|||+|++++++++++++.
T Consensus         1 iI~p~D~~~ik~I~kAI~~s~l~lnP~v-------~~P~~T~E~R~~l~K~~k~~~E~aKv~iRniR~~~~~~iKk~kk~   73 (113)
T 1y69_8            1 MISDIRKDAEVRMDKCVEAFKTQISKIR-------TGGGGTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKD   73 (113)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHGGGTC-------CSSCCSSSTTHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHTTTTS
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCC-------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9756885689999999999877987114-------799977368999999999999999999999999999999987524


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8999789988899999999999999999999999887449
Q gi|254780776|r  147 GKASEDMVASLENDIQKITDSTIKNIDSFFEEKKKEIMHF  186 (186)
Q Consensus       147 ~~iseD~~~~~~~~iq~lt~~~~~~id~~~~~Kekell~~  186 (186)
                      +++|||+.++++++||++||+|++++|++++.||||||+|
T Consensus        74 ~~iseD~~k~~e~~iqkltd~~~~~id~~~~~Kekeim~v  113 (113)
T 1y69_8           74 KEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELMQF  113 (113)
T ss_dssp             SSCCSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             8788678887999999999999999999999999998479



>1wih_A (A:) Mitochondrial ribosome recycling factor; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} Back     alignment and structure
>1ise_A (A:33-104) Ribosome recycling factor; translation; 2.20A {Escherichia coli} Back     alignment and structure
>1wqg_A (A:33-104) Ribosome recycling factor; translation factor, triple-helix bundle, protein synthesis; 2.15A {Mycobacterium tuberculosis} Back     alignment and structure
>1is1_A (A:33-104) Ribosome recycling factor; translation; 2.20A {Vibrio parahaemolyticus} Back     alignment and structure
>1dd5_A (A:34-104) Ribosome recycling factor; three-helix bundle, beta-alpha-beta sandwich; 2.55A {Thermotoga maritima} Back     alignment and structure
>1eh1_A (A:36-105) Ribosome recycling factor; translation, hinge variability; 2.60A {Thermus thermophilus} Back     alignment and structure
>1ge9_A (A:37-106) Ribosome recycling factor; three-helix bundle; NMR {Aquifex aeolicus} Back     alignment and structure
>1ise_A (A:1-32,A:105-185) Ribosome recycling factor; translation; 2.20A {Escherichia coli} Back     alignment and structure
>1is1_A (A:1-32,A:105-185) Ribosome recycling factor; translation; 2.20A {Vibrio parahaemolyticus} Back     alignment and structure
>1eh1_A (A:1-35,A:106-185) Ribosome recycling factor; translation, hinge variability; 2.60A {Thermus thermophilus} Back     alignment and structure
>1wqg_A (A:1-32,A:105-185) Ribosome recycling factor; translation factor, triple-helix bundle, protein synthesis; 2.15A {Mycobacterium tuberculosis} Back     alignment and structure
>1ge9_A (A:1-36,A:107-184) Ribosome recycling factor; three-helix bundle; NMR {Aquifex aeolicus} Back     alignment and structure
>1dd5_A (A:1-33,A:105-185) Ribosome recycling factor; three-helix bundle, beta-alpha-beta sandwich; 2.55A {Thermotoga maritima} Back     alignment and structure