254780777

254780777

uridylate kinase

GeneID in NCBI database:8209783Locus tag:CLIBASIA_03340
Protein GI in NCBI database:254780777Protein Accession:YP_003065190.1
Gene range:+(485335, 486063)Protein Length:242aa
Gene description:uridylate kinase
COG prediction:[F] Uridylate kinase
KEGG prediction:pyrH; uridylate kinase (EC:2.7.4.22); K09903 uridylate kinase [EC:2.7.4.22]
SEED prediction:Uridylate kinase (EC 2.7.4.-)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIISGE
ccccccEEEEEEEccEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHccHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHccccEEEEEEccccccccccccccccEEcccccHHHHHHcccccccHHHHHHHHHccccEEEEEcccccHHHHHHcccccccEEccc
ccccccEEEEEEEcHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHccccEEEEEccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHcccccEEEEEccccccHHHEEEcccccEEEccc
MSDFPYKRVLLKVSGEALagisgfgvdidsVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRkinvptvilssifmpqvcevfscrnavsylsqGKVVIfsggtgnaflTTDSAAALRASEIGADvilkgtqvdgvysadprvhasstrfdslTYNQFIEKGLKVMDCASvvlardcsipiivfsihspggiwgglsgigrstiisge
MSDFPYKRVLLKVSGEALagisgfgvdidsVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRvhasstrfdslTYNQFIEKGLKVMDCASVVLARDCSIPIIVFsihspggiwgglsgigrstiisge
MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKgieigivvgggniFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPggiwgglsgigRSTIISGE
***FPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTII***
MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIISGE
**DFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIISG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIISGE
MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIISGE
MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIISGE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target242 uridylate kinase [Candidatus Liberibacter asiaticus str
254780873 411 aspartate kinase [Candidatus Liberibacter asiaticu 3e-05
>gi|254780873|ref|YP_003065286.1| aspartate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 411 Back     alignment
 Score = 40.4 bits (93), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 104/225 (46%), Gaps = 32/225 (14%)

Query: 8   RVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGG--GNIFRGSQVVA 65
           R+++K  G ++A       +ID +      +     +G E+ +VV    G   R +++  
Sbjct: 3   RIVMKFGGTSVA-------NIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCR 55

Query: 66  ENYLL---CERSTVDSMG-MLSTVINALALD------LALRKINVPTVILSSIFMPQVCE 115
           +   +    ER  V S G  +S+ +  LAL       ++L+   +P +  S   M ++C 
Sbjct: 56  QVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICR 115

Query: 116 VFSCRNAVSYLSQGKVVIFSGGTG----NAFLT-----TDSAAALRASEIGADVILKGTQ 166
           V   +  V++L + +VV+ +G  G    N+  T     +D++A   A+ I AD     T 
Sbjct: 116 VDE-KKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTD 174

Query: 167 VDGVYSADPRVHASSTRFDSLTYNQFIEK---GLKVMDCASVVLA 208
           V G+Y+ DPR+   +     +++ + +E    G KVM   SV LA
Sbjct: 175 VCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELA 219

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target242 uridylate kinase [Candidatus Liberibacter asiaticus str
170785426242 uridylate kinase [Candidatus Liberibacter asiaticus] Le 1 1e-135
315121994242 uridylate kinase [Candidatus Liberibacter solanacearum 1 1e-105
163868103239 uridylate kinase [Bartonella tribocorum CIP 105476] Len 1 5e-76
240850306239 uridylate kinase [Bartonella grahamii as4aup] Length = 1 7e-76
121601644239 uridylate kinase [Bartonella bacilliformis KC583] Lengt 1 3e-75
49475412239 uridylate kinase [Bartonella henselae str. Houston-1] L 1 3e-74
319407372239 Uridylate kinase [Bartonella sp. 1-1C] Length = 239 1 4e-74
319899041238 Uridylate kinase [Bartonella clarridgeiae 73] Length = 1 5e-74
319404369239 Uridylate kinase [Bartonella rochalimae ATCC BAA-1498] 1 7e-74
319408397239 Uridylate kinase [Bartonella schoenbuchensis R1] Length 1 7e-74
>gi|170785426|gb|ACB37707.1| uridylate kinase [Candidatus Liberibacter asiaticus] Length = 242 Back     alignment and organism information
 Score =  483 bits (1244), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 241/242 (99%), Positives = 242/242 (100%)

Query: 1   MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRG 60
           MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRG
Sbjct: 1   MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRG 60

Query: 61  SQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCR 120
           SQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCR
Sbjct: 61  SQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCR 120

Query: 121 NAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHAS 180
           NAVSYLSQG+VVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHAS
Sbjct: 121 NAVSYLSQGRVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHAS 180

Query: 181 STRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIIS 240
           STRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIIS
Sbjct: 181 STRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIIS 240

Query: 241 GE 242
           GE
Sbjct: 241 GE 242


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121994|ref|YP_004062483.1| uridylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 242 Back     alignment and organism information
>gi|163868103|ref|YP_001609307.1| uridylate kinase [Bartonella tribocorum CIP 105476] Length = 239 Back     alignment and organism information
>gi|240850306|ref|YP_002971699.1| uridylate kinase [Bartonella grahamii as4aup] Length = 239 Back     alignment and organism information
>gi|121601644|ref|YP_988894.1| uridylate kinase [Bartonella bacilliformis KC583] Length = 239 Back     alignment and organism information
>gi|49475412|ref|YP_033453.1| uridylate kinase [Bartonella henselae str. Houston-1] Length = 239 Back     alignment and organism information
>gi|319407372|emb|CBI81023.1| Uridylate kinase [Bartonella sp. 1-1C] Length = 239 Back     alignment and organism information
>gi|319899041|ref|YP_004159134.1| Uridylate kinase [Bartonella clarridgeiae 73] Length = 238 Back     alignment and organism information
>gi|319404369|emb|CBI77972.1| Uridylate kinase [Bartonella rochalimae ATCC BAA-1498] Length = 239 Back     alignment and organism information
>gi|319408397|emb|CBI82052.1| Uridylate kinase [Bartonella schoenbuchensis R1] Length = 239 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 uridylate kinase [Candidatus Liberibacter asiaticus str
PRK00358231 PRK00358, pyrH, uridylate kinase; Provisional 3e-85
TIGR02075233 TIGR02075, pyrH_bact, uridylate kinase 4e-81
COG0528238 COG0528, PyrH, Uridylate kinase [Nucleotide transport a 4e-73
cd04239229 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK 9e-69
PRK14558231 PRK14558, pyrH, uridylate kinase; Provisional 1e-48
PRK14556249 PRK14556, pyrH, uridylate kinase; Provisional 2e-45
PRK14557247 PRK14557, pyrH, uridylate kinase; Provisional 1e-42
pfam00696230 pfam00696, AA_kinase, Amino acid kinase family 9e-21
cd04253221 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase 1e-20
TIGR02076221 TIGR02076, pyrH_arch, uridylate kinase, putative 1e-17
cd02115248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, cat 5e-14
COG1608252 COG1608, COG1608, Predicted archaeal kinase [General fu 0.004
cd04254231 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the mi 5e-81
cd04246239 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid 3e-13
cd04261239 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid 1e-12
TIGR00657 441 TIGR00657, asp_kinases, aspartate kinase 6e-10
TIGR00656 401 TIGR00656, asp_kin_monofn, aspartate kinase, monofuncti 6e-10
COG0527 447 COG0527, LysC, Aspartokinases [Amino acid transport and 1e-09
cd04234227 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily 2e-09
PRK08210 403 PRK08210, PRK08210, aspartate kinase I; Reviewed 3e-09
PRK06635 404 PRK06635, PRK06635, aspartate kinase; Reviewed 5e-08
cd04260244 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid K 6e-08
cd04243293 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid 7e-07
PRK07431 587 PRK07431, PRK07431, aspartate kinase; Provisional 2e-06
cd04257294 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Su 4e-06
PRK08841 392 PRK08841, PRK08841, aspartate kinase; Validated 4e-06
cd04244298 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid 1e-05
cd04245288 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Ac 2e-05
PRK09084 448 PRK09084, PRK09084, aspartate kinase III; Validated 6e-05
KOG0456 559 KOG0456, KOG0456, KOG0456, Aspartate kinase [Amino acid 8e-05
cd04259295 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase 1e-04
PRK09436 819 PRK09436, thrA, bifunctional aspartokinase I/homoserine 1e-04
PRK06291 465 PRK06291, PRK06291, aspartate kinase; Provisional 1e-04
PRK08961 861 PRK08961, PRK08961, bifunctional aspartate kinase/diami 2e-04
PRK05925 440 PRK05925, PRK05925, aspartate kinase; Provisional 0.003
cd04258292 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Ac 8e-07
COG0263 369 COG0263, ProB, Glutamate 5-kinase [Amino acid transport 0.002
PRK05429 372 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional 0.004
>gnl|CDD|178986 PRK00358, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|131130 TIGR02075, pyrH_bact, uridylate kinase Back     alignment and domain information
>gnl|CDD|30874 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|58605 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173021 PRK14556, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173022 PRK14557, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|144336 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|58619 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>gnl|CDD|162687 TIGR02076, pyrH_arch, uridylate kinase, putative Back     alignment and domain information
>gnl|CDD|58599 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>gnl|CDD|31796 COG1608, COG1608, Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|58620 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>gnl|CDD|58612 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>gnl|CDD|58627 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>gnl|CDD|161982 TIGR00657, asp_kinases, aspartate kinase Back     alignment and domain information
>gnl|CDD|161981 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class Back     alignment and domain information
>gnl|CDD|30873 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|58600 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>gnl|CDD|181293 PRK08210, PRK08210, aspartate kinase I; Reviewed Back     alignment and domain information
>gnl|CDD|180641 PRK06635, PRK06635, aspartate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|58626 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>gnl|CDD|58609 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|180976 PRK07431, PRK07431, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|58623 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|181563 PRK08841, PRK08841, aspartate kinase; Validated Back     alignment and domain information
>gnl|CDD|58610 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>gnl|CDD|58611 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>gnl|CDD|181643 PRK09084, PRK09084, aspartate kinase III; Validated Back     alignment and domain information
>gnl|CDD|35677 KOG0456, KOG0456, KOG0456, Aspartate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|58625 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>gnl|CDD|181856 PRK09436, thrA, bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|180515 PRK06291, PRK06291, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|181596 PRK08961, PRK08961, bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>gnl|CDD|135659 PRK05925, PRK05925, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|58624 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>gnl|CDD|30612 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180076 PRK05429, PRK05429, gamma-glutamyl kinase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 242 uridylate kinase [Candidatus Liberibacter asiaticus str
PRK00358231 pyrH uridylate kinase; Provisional 100.0
cd04254231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/ch 100.0
cd04239229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, th 100.0
TIGR02075236 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridyla 100.0
TIGR01027 379 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamat 100.0
COG0528238 PyrH Uridylate kinase [Nucleotide transport and metabol 100.0
PRK12314265 gamma-glutamyl kinase; Provisional 100.0
PRK12443247 uridylate kinase; Reviewed 100.0
PRK05429 372 gamma-glutamyl kinase; Provisional 100.0
PRK13402 363 gamma-glutamyl kinase; Provisional 100.0
COG0263 369 ProB Glutamate 5-kinase [Amino acid transport and metab 100.0
cd04242251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) cat 100.0
cd04256284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) 100.0
cd04253221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf 100.0
TIGR00657 504 asp_kinases aspartate kinase; InterPro: IPR001341 Bacte 100.0
TIGR02076232 pyrH_arch uridylate kinase, putative; InterPro: IPR0118 100.0
PRK07431 594 aspartate kinase; Provisional 100.0
cd04246239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Su 100.0
COG0527 447 LysC Aspartokinases [Amino acid transport and metabolis 100.0
cd04261239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Su 100.0
PRK08841 392 aspartate kinase; Validated 100.0
PRK06635 402 aspartate kinase; Reviewed 100.0
cd04260244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Supe 100.0
PRK08210 405 aspartate kinase I; Reviewed 100.0
cd04241252 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomy 100.0
PRK06291 466 aspartate kinase; Provisional 100.0
KOG1154285 consensus 100.0
cd02115248 AAK Amino Acid Kinases (AAK) superfamily, catalytic dom 100.0
PRK08961 865 bifunctional aspartate kinase/diaminopimelate decarboxy 100.0
cd04244298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Su 100.0
cd04259295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamil 100.0
PRK05925 440 aspartate kinase; Provisional 100.0
cd04234227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Asp 100.0
PRK09436 817 thrA bifunctional aspartokinase I/homeserine dehydrogen 100.0
PRK09466 810 metL bifunctional aspartate kinase II/homoserine dehydr 100.0
cd04257294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily 100.0
TIGR01092 738 P5CS delta l-pyrroline-5-carboxylate synthetase; InterP 100.0
cd04247306 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily 100.0
cd04258292 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase 100.0
PRK09084 447 aspartate kinase III; Validated 100.0
PRK08373359 aspartate kinase; Validated 100.0
cd04243293 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Su 100.0
PRK09034 450 aspartate kinase; Reviewed 100.0
cd04245288 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase 100.0
COG1608252 Predicted archaeal kinase [General function prediction 99.98
pfam00696230 AA_kinase Amino acid kinase family. This family include 99.97
cd04255262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alp 99.97
PRK00942262 acetylglutamate kinase; Provisional 99.9
TIGR02078341 AspKin_pair Pyrococcus aspartate kinase subunit, putati 99.9
cd04240203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-l 99.9
cd04238256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinas 99.89
KOG0456 559 consensus 99.88
cd04250279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cy 99.87
TIGR00656 480 asp_kin_monofn asparate kinase, monofunctional class; I 99.84
cd04249252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - 99.81
cd04251257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - 99.79
CHL00202284 argB acetylglutamate kinase; Provisional 99.78
PRK12353312 carbamate kinase; Reviewed 99.78
COG0548265 ArgB Acetylglutamate kinase [Amino acid transport and m 99.78
cd04237280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kina 99.75
COG2054212 Uncharacterized archaeal kinase related to aspartokinas 99.72
PRK12454313 carbamate kinase-like carbamoyl phosphate synthetase; R 99.72
PRK12686313 carbamate kinase; Reviewed 99.72
PRK05279 441 N-acetylglutamate synthase; Validated 99.69
cd04235308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the 99.66
cd04252248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate k 99.63
PRK09411297 carbamate kinase; Reviewed 99.61
TIGR00761254 argB acetylglutamate kinase; InterPro: IPR004662 N -Ace 99.61
PRK12352316 putative carbamate kinase; Reviewed 99.6
PRK12354302 carbamate kinase; Reviewed 99.57
COG0549312 ArcC Carbamate kinase [Amino acid transport and metabol 99.55
TIGR00746321 arcC carbamate kinase; InterPro: IPR003964 The arginine 99.47
cd04236271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) ki 99.45
PRK04531 421 acetylglutamate kinase; Provisional 99.24
TIGR01890 439 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro 98.86
cd04248304 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superf 99.95
PRK09181 476 aspartate kinase; Validated 99.95
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase; InterPro: I 91.64
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamate 5-phosphotransferase, (gamma-glutamyl kinase, proB, 2 Back     alignment and domain information
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK12443 uridylate kinase; Reviewed Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase; InterPro: IPR001341 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative; InterPro: IPR011818 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>KOG1154 consensus Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>PRK05925 aspartate kinase; Provisional Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homeserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase; InterPro: IPR005766 delta l-pyrroline-5-carboxylate synthetase contains a glutamate 5-kinase (ProB, 2 Back     alignment and domain information
>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PRK08373 aspartate kinase; Validated Back     alignment and domain information
>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>pfam00696 AA_kinase Amino acid kinase family Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative; InterPro: IPR011819 This family consists of proteins restricted to and found as paralogous pairs (typically close together) in species of Pyrococcus, a hyperthermophilic archaeal genus Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>KOG0456 consensus Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>TIGR00656 asp_kin_monofn asparate kinase, monofunctional class; InterPro: IPR005260 Aspartate kinase catalyzes the first step in the biosynthesis of Lys (via its precursor diaminopimelate), Met, and Thr Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>PRK12353 carbamate kinase; Reviewed Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>COG2054 Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only] Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP) Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase; InterPro: IPR004662 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00746 arcC carbamate kinase; InterPro: IPR003964 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes Back     alignment and domain information
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro: IPR010167 This entry represents a clade of amino-acid N-acetyltransferases, or N-acetylglutamate synthase, which is the product of the argA gene and the first enzyme in arginine biosynthesis Back     alignment and domain information
>cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase; InterPro: IPR010039 This entry describes a small family of highly conserved proteins (>60 0dentity) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target242 uridylate kinase [Candidatus Liberibacter asiaticus str
3ek5_A243 Unique Gtp-Binding Pocket And Allostery Of Ump Kina 7e-48
2bnd_A241 The Structure Of E.Coli Ump Kinase In Complex With 2e-45
2bne_A241 The Structure Of E. Coli Ump Kinase In Complex With 3e-45
3nwy_A281 Structure And Allosteric Regulation Of The Uridine 6e-44
2a1f_A247 Crystal Structure Of Uridylate Kinase Length = 247 3e-43
2bnf_A241 The Structure Of E. Coli Ump Kinase In Complex With 2e-42
1z9d_A252 Crystal Structure Of A Putative Uridylate Kinase (U 6e-40
1ybd_A239 Crystal Structure Analysis Of Uridylate Kinase From 8e-36
2jjx_A255 The Crystal Structure Of Ump Kinase From Bacillus A 9e-33
2va1_A256 Crystal Structure Of Ump Kinase From Ureaplasma Par 3e-28
3l76_A 600 Crystal Structure Of Aspartate Kinase From Synechoc 2e-25
2j5t_A 357 Glutamate 5-Kinase From Escherichia Coli Complexed 3e-23
2w21_A259 Crystal Structure Of The Aminoacid Kinase Domain Of 5e-23
2j5t_G 358 Glutamate 5-Kinase From Escherichia Coli Complexed 5e-23
2j5t_C 357 Glutamate 5-Kinase From Escherichia Coli Complexed 6e-23
2j5t_F 356 Glutamate 5-Kinase From Escherichia Coli Complexed 6e-23
2j5t_E 367 Glutamate 5-Kinase From Escherichia Coli Complexed 6e-23
2j5v_A 367 Glutamate 5-Kinase From Escherichia Coli Complexed 7e-23
2j5t_B 354 Glutamate 5-Kinase From Escherichia Coli Complexed 1e-22
3ab4_A 421 Crystal Structure Of Feedback Inhibition Resistant 2e-18
3aaw_A 421 Crystal Structure Of Aspartate Kinase From Coryneba 2e-18
2brx_A244 Ump Kinase From Pyrococcus Furiosus Without Ligands 7e-18
2ji5_A227 Structure Of Ump Kinase From Pyrococcus Furiosus Co 4e-17
2bmu_A226 Ump Kinase From Pyrococcus Furiosus Complexed With 7e-16
2bri_A225 Ump Kinase From Pyrococcus Furiosus Complexed With 7e-16
2ako_A251 Crystal Structure Of Glutamate 5-Kinase From Campyl 4e-14
2ij9_A219 Crystal Structure Of Uridylate Kinase From Archaeog 6e-14
2ogx_B270 The Crystal Structure Of The Molybdenum Storage Pro 2e-13
3ll9_A269 X-Ray Structures Of Isopentenyl Phosphate Kinase Le 3e-13
2cdq_A 510 Crystal Structure Of Arabidopsis Thaliana Aspartate 6e-11
2j4j_A226 Crystal Structure Of Uridylate Kinase From Sulfolob 9e-11
3k4o_A266 Crystal Structure Of Isopentenyl Phosphate Kinase F 2e-08
2ogx_A276 The Crystal Structure Of The Molybdenum Storage Pro 5e-05
3lkk_A249 Crystal Structure Of The Isopentenyl Phosphate Kina 0.003
2hmf_A 469 Structure Of A Threonine Sensitive Aspartokinase Fr 2e-14
3c1n_C 473 Crystal Structure Of Allosteric Inhibition Threonin 2e-14
2j0x_B 446 Crystal Structure Of E. Coli Aspartokinase Iii In C 8e-07
2j0w_A 448 Crystal Structure Of E. Coli Aspartokinase Iii In C 8e-07
2j0x_A 449 Crystal Structure Of E. Coli Aspartokinase Iii In C 8e-07
1e19_A314 Structure Of The Carbamate Kinase-Like Carbamoyl Ph 0.001
>gi|218766699|pdb|3EK5|A Chain A, Unique Gtp-Binding Pocket And Allostery Of Ump Kinase From A Gram-Negative Phytopathogen Bacterium Length = 243 Back     alignment and structure
 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 162/241 (67%), Gaps = 3/241 (1%)

Query: 1   MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRG 60
           MS+  Y+R+LLK+SGEAL G   +G+D   +NR+  ++ E    G ++ +V+GGGNIFRG
Sbjct: 4   MSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRG 63

Query: 61  SQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCR 120
           + + A      +R T D MGML+TVINALA+  AL K+     ++S+I +  VCE F  R
Sbjct: 64  AGLAASG---MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRR 120

Query: 121 NAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHAS 180
            A+ +L +G++ IF+ GTGN F TTDS AALRA EIGAD++LK T+VDGVY  DP+ H+ 
Sbjct: 121 RAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSD 180

Query: 181 STRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIIS 240
           + R+DSLTY++ I +GL+VMD A+  LARD  +P+ +F +  PG +   L G    T++ 
Sbjct: 181 AVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQ 240

Query: 241 G 241
           G
Sbjct: 241 G 241


>gi|75766453|pdb|2BND|A Chain A, The Structure Of E.Coli Ump Kinase In Complex With Udp Length = 241 Back     alignment and structure
>gi|66361575|pdb|2BNE|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Ump Length = 241 Back     alignment and structure
>gi|304446039|pdb|3NWY|A Chain A, Structure And Allosteric Regulation Of The Uridine Monophosphate Kinase From Mycobacterium Tuberculosis Length = 281 Back     alignment and structure
>gi|71042600|pdb|2A1F|A Chain A, Crystal Structure Of Uridylate Kinase Length = 247 Back     alignment and structure
>gi|66361579|pdb|2BNF|A Chain A, The Structure Of E. Coli Ump Kinase In Complex With Utp Length = 241 Back     alignment and structure
>gi|66361391|pdb|1Z9D|A Chain A, Crystal Structure Of A Putative Uridylate Kinase (Ump- Kinase) From Streptococcus Pyogenes Length = 252 Back     alignment and structure
>gi|61680562|pdb|1YBD|A Chain A, Crystal Structure Analysis Of Uridylate Kinase From Neisseria Meningitidis Length = 239 Back     alignment and structure
>gi|194708941|pdb|2JJX|A Chain A, The Crystal Structure Of Ump Kinase From Bacillus Anthracis (Ba1797) Length = 255 Back     alignment and structure
>gi|158431154|pdb|2VA1|A Chain A, Crystal Structure Of Ump Kinase From Ureaplasma Parvum Length = 256 Back     alignment and structure
gi|297787670|pdb|3L76|A Chain A, Crystal Structure Of Aspartate Kinase From Synechocystis Length = 600 Back     alignment and structure
>gi|268612106|pdb|2W21|A Chain A, Crystal Structure Of The Aminoacid Kinase Domain Of The Glutamate 5 Kinase Of Escherichia Coli Length = 259 Back     alignment and structure
>gi|134104656|pdb|2J5V|A Chain A, Glutamate 5-Kinase From Escherichia Coli Complexed With Glutamyl-5-Phosphate And Pyroglutamic Acid Length = 367 Back     alignment and structure
>gi|299688892|pdb|3AB4|A Chain A, Crystal Structure Of Feedback Inhibition Resistant Mutant Of Aspartate Kinase From Corynebacterium Glutamicum In Complex With Lysine And Threonine Length = 421 Back     alignment and structure
gi|299688865|pdb|3AAW|A Chain A, Crystal Structure Of Aspartate Kinase From Corynebacterium Glutamicum In Complex With Lysine And Threonine Length = 421 Back     alignment and structure
>gi|73536289|pdb|2BRX|A Chain A, Ump Kinase From Pyrococcus Furiosus Without Ligands Length = 244 Back     alignment and structure
>gi|158428975|pdb|2JI5|A Chain A, Structure Of Ump Kinase From Pyrococcus Furiosus Complexed With Utp Length = 227 Back     alignment and structure
>gi|73536269|pdb|2BMU|A Chain A, Ump Kinase From Pyrococcus Furiosus Complexed With Its Substrate Ump And Its Substrate Analog Amppnp Length = 226 Back     alignment and structure
>gi|73536282|pdb|2BRI|A Chain A, Ump Kinase From Pyrococcus Furiosus Complexed With Its Substrate Analog Amppnp Length = 225 Back     alignment and structure
>gi|75766266|pdb|2AKO|A Chain A, Crystal Structure Of Glutamate 5-Kinase From Campylobacter Jejuni Length = 251 Back     alignment and structure
>gi|118138442|pdb|2IJ9|A Chain A, Crystal Structure Of Uridylate Kinase From Archaeoglobus Fulgidus Length = 219 Back     alignment and structure
>gi|146387020|pdb|2OGX|B Chain B, The Crystal Structure Of The Molybdenum Storage Protein From Azotobacter Vinelandii Loaded With Polyoxotungstates (Wsto) Length = 270 Back     alignment and structure
>gi|297343038|pdb|3LL9|A Chain A, X-Ray Structures Of Isopentenyl Phosphate Kinase Length = 269 Back     alignment and structure
>gi|313507235|pdb|2CDQ|A Chain A, Crystal Structure Of Arabidopsis Thaliana Aspartate Kinase Complexed With Lysine And S-Adenosylmethionine Length = 510 Back     alignment and structure
gi|134104608|pdb|2J4J|A Chain A, Crystal Structure Of Uridylate Kinase From Sulfolobus Solfataricus In Complex With Ump And Amppcp To 2.1 Angstrom Resolution Length = 226 Back     alignment and structure
>gi|295789369|pdb|3K4O|A Chain A, Crystal Structure Of Isopentenyl Phosphate Kinase From Methanocaldococcus Jannaschii Length = 266 Back     alignment and structure
>gi|146387019|pdb|2OGX|A Chain A, The Crystal Structure Of The Molybdenum Storage Protein From Azotobacter Vinelandii Loaded With Polyoxotungstates (Wsto) Length = 276 Back     alignment and structure
>gi|297343032|pdb|3LKK|A Chain A, Crystal Structure Of The Isopentenyl Phosphate Kinase Substr Complex Length = 249 Back     alignment and structure
>gi|118137941|pdb|2HMF|A Chain A, Structure Of A Threonine Sensitive Aspartokinase From Methanococcus Jannaschii Complexed With Mg-Adp And Aspartate Length = 469 Back     alignment and structure
gi|170785206|pdb|3C1N|C Chain C, Crystal Structure Of Allosteric Inhibition Threonine- Sensitive Aspartokinase From Methanococcus Jannaschii With L-Threonine Length = 473 Back     alignment and structure
gi|9955156|pdb|1E19|A Chain A, Structure Of The Carbamate Kinase-Like Carbamoyl Phosphate Synthetase From The Hyperthermophilic Archaeon Pyrococcus Furiosus Bound To Adp Length = 314 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242 uridylate kinase [Candidatus Liberibacter asiaticus str
3ek6_A243 Uridylate kinase; UMPK unique GTP binding site, alloste 1e-42
3nwy_A281 Uridylate kinase; allosterically activated form, AAK fo 5e-42
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, pyri 1e-36
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genomics, 1e-35
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, prote 2e-35
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, struc 7e-35
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine biosynt 1e-32
2j4j_A226 Uridylate kinase; transferase, nucleoside monophosphate 4e-27
2ogx_A276 Molybdenum storage protein subunit alpha; open alpha/be 5e-24
2ij9_A219 Uridylate kinase; structural genomics, protein structur 1e-23
2ogx_B270 Molybdenum storage protein subunit beta; open alpha/bet 1e-23
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, phosph 7e-23
3ll5_A249 Gamma-glutamyl kinase related protein; alternate mevalo 1e-22
3k4o_A266 Isopentenyl phosphate kinase; small molecule kinase, AT 6e-18
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthesis i 1e-14
2rd5_A298 Acetylglutamate kinase-like protein; protein-protein co 4e-04
3d40_A286 FOMA protein; fosfomycin, antibiotic resistance, kinase 3e-11
2ako_A251 Glutamate 5-kinase; structural genomics, PSI, protein s 6e-08
1e19_A314 Carbamate kinase-like carbamoylphosphate synthetase; tr 7e-08
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma glutamy 0.002
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibition, 4e-07
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase transfera 4e-06
>3ek6_A Uridylate kinase; UMPK unique GTP binding site, allosteric regulation, ATP-binding, cytoplasm kinase, nucleotide-binding; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A Length = 243 Back     alignment and structure
 Score =  168 bits (425), Expect = 1e-42
 Identities = 111/242 (45%), Positives = 159/242 (65%), Gaps = 3/242 (1%)

Query: 1   MSDFPYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRG 60
           MS+  Y+R+LLK+SGEAL G   +G+D   +NR+  ++ E    G ++ +V+GGGNIFRG
Sbjct: 4   MSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRG 63

Query: 61  SQVVAENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCR 120
           + + A           D MGML+TVINALA+  AL K+     ++S+I +  VCE F  R
Sbjct: 64  AGLAASGMDRVTG---DHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRR 120

Query: 121 NAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHAS 180
            A+ +L +G++ IF+ GTGN F TTDS AALRA EIGAD++LK T+VDGVY  DP+ H+ 
Sbjct: 121 RAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSD 180

Query: 181 STRFDSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIIS 240
           + R+DSLTY++ I +GL+VMD A+  LARD  +P+ +F +  PG +   L G    T++ 
Sbjct: 181 AVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQ 240

Query: 241 GE 242
           G 
Sbjct: 241 GR 242


>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis} Length = 281 Back     alignment and structure
>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis} Length = 255 Back     alignment and structure
>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3 Length = 252 Back     alignment and structure
>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A* Length = 247 Back     alignment and structure
>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, protein structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3 Length = 239 Back     alignment and structure
>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum} Length = 256 Back     alignment and structure
>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A* Length = 226 Back     alignment and structure
>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 276 Back     alignment and structure
>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.90A {Archaeoglobus fulgidus dsm 4304} SCOP: c.73.1.3 Length = 219 Back     alignment and structure
>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii} Length = 270 Back     alignment and structure
>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A* Length = 244 Back     alignment and structure
>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A* Length = 249 Back     alignment and structure
>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A* Length = 266 Back     alignment and structure
>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 269 Back     alignment and structure
>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis, nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298 Back     alignment and structure
>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* Length = 286 Back     alignment and structure
>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3 Length = 251 Back     alignment and structure
>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1 Length = 314 Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* Length = 367 Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Length = 421 Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Length = 600 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target242 uridylate kinase [Candidatus Liberibacter asiaticus str
3ek6_A243 Uridylate kinase; UMPK unique GTP binding site, alloste 100.0
3nwy_A281 Uridylate kinase; allosterically activated form, AAK fo 100.0
2a1f_A247 Uridylate kinase; PYRH, structural genomics, PSI, prote 100.0
1ybd_A239 Uridylate kinase; alpha/beta/alpha fold, hexamer, struc 100.0
2jjx_A255 Uridylate kinase, UMP kinase; structural genomics, pyri 100.0
2j5v_A 367 Glutamate 5-kinase; proline biosynthesis, gamma glutamy 100.0
1z9d_A252 Uridylate kinase, UK, UMP kinase; structural genomics, 100.0
2va1_A256 Uridylate kinase; UMPK, transferase, pyrimidine biosynt 100.0
2j4j_A226 Uridylate kinase; transferase, nucleoside monophosphate 100.0
2brx_A244 Uridylate kinase; UMP kinase, amino acid kinase, phosph 100.0
2ij9_A219 Uridylate kinase; structural genomics, protein structur 100.0
2ako_A251 Glutamate 5-kinase; structural genomics, PSI, protein s 100.0
2ogx_B270 Molybdenum storage protein subunit beta; open alpha/bet 100.0
3ll9_A269 Isopentenyl phosphate kinase; mevalonate biosynthesis i 100.0
3ab4_A 421 Aspartokinase; aspartate kinase, concerted inhibition, 100.0
3l76_A 600 Aspartokinase; allostery, ACT domains, kinase transfera 100.0
3d40_A286 FOMA protein; fosfomycin, antibiotic resistance, kinase 100.0
3ll5_A249 Gamma-glutamyl kinase related protein; alternate mevalo 100.0
2ogx_A276 Molybdenum storage protein subunit alpha; open alpha/be 100.0
2j0w_A