254780791

254780791

exodeoxyribonuclease VII large subunit

GeneID in NCBI database:8209797Locus tag:CLIBASIA_03410
Protein GI in NCBI database:254780791Protein Accession:YP_003065204.1
Gene range:-(468451, 470040)Protein Length:529aa
Gene description:exodeoxyribonuclease VII large subunit
COG prediction:[L] Exonuclease VII, large subunit
KEGG prediction:xseA; exodeoxyribonuclease VII large subunit (EC:3.1.11.6); K03601 exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
SEED prediction:Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)
Pathway involved in KEGG:Mismatch repair [PATH:las03430]
Subsystem involved in SEED:DNA repair, bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53
MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF
ccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccEEEEEEEccccEEEEEEEcccccccccccccccEEEEEEEEEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccHHHcccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHcccccccccccEEEEEcccccHHHHHHccHHHHHHHHHcccccEEEEcccccHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccEEEEcccccEEccHHHcccccEEEEEEEEEEEEEEEEEccccccccccccccccccccccccccccc
cccHHHccccccccEEHHHHHHHHHHHHHHcccEEEEEEEEccccccccccEEEEEEcccccEEEEEEEccccEEEEEccccccEEEEEEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccccHHHcccccccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHccHHHHHHHHHHccccEEEEccccccEEHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccEEEEcccccEEEEHHHcccccEEEEEEEccEEEEEEEcccccccccccccccccccccccccccccc
mnpfsqknsldhpeysvSELSYHLKHIVesnlshvcvrgeisgyrgihssghayfslkdnhsRIDAIIWkgtlnkieflpeegiEFLVIGKittfpgsskYQIIIESlipsgsgtLLTALEKRKKKLLEeglfsdqhknpipfipKIIAVITSPTGAVIRDILQRISCRFPLRVIIFpvkvqgdecPKEIANAILQLNtlkegrtcprpdiiilargggsiedlWHFNDEMIVRAIANSSipiisaighetdwtLADYaadlraptptgaaemAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLkalpnsdqtlscsryrldrlpreLEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHkikschtsVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFfdgqanaivinkappkeqptkkcqlhnnkrekqgtqgelf
mnpfsqknsldhpeYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESlipsgsgtLLTALEKRKKKLLEeglfsdqhknpipFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQlntlkegrtcpRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLkalpnsdqtlsCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGytsiqdtnnnfitQKRNLATKTRILINFFDGQANAIVINkappkeqptkkcqlhnnkrekqgtqgelf
MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTlltalekrkkklleeglFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRaianssipiisaiGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF
***************SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL***********LEKQQHIEQIVKQHLRYIF*******************RIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQAN*********************************F
*************EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNN************
**********DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINK****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF
MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF
MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target529 exodeoxyribonuclease VII large subunit [Candidatus Libe
315122013533 exodeoxyribonuclease VII large subunit [Candidatus Libe 1 0.0
116250050526 exodeoxyribonuclease VII large subunit [Rhizobium legum 1 1e-138
190889943526 exodeoxyribonuclease VII protein, large subunit [Rhizob 1 1e-137
222084548571 exodeoxyribonuclease VII, large subunit [Agrobacterium 1 1e-136
327191973526 exodeoxyribonuclease VII protein, large subunit [Rhizob 1 1e-133
241207230526 exodeoxyribonuclease VII large subunit [Rhizobium legum 1 1e-133
150398684526 exodeoxyribonuclease VII large subunit [Sinorhizobium m 1 1e-132
227824137527 exodeoxyribonuclease VII large subunit [Sinorhizobium f 1 1e-132
325291705534 exodeoxyribonuclease VII large subunit [Agrobacterium s 1 1e-132
209551852527 exodeoxyribonuclease VII large subunit [Rhizobium legum 1 1e-132
>gi|315122013|ref|YP_004062502.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 533 Back     alignment and organism information
 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/533 (71%), Positives = 445/533 (83%), Gaps = 4/533 (0%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MN   QKNSL  PEYSVSELSYHLK+ VES   +V VRGEISGYRGIH+SGHAYFSLKDN
Sbjct: 1   MNSSPQKNSLTLPEYSVSELSYHLKNTVESKFPYVFVRGEISGYRGIHASGHAYFSLKDN 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            SRIDA+IWKGTL+KIE  PEEGIEFL +GKITTFPGSSKYQIIIESLIPSGSG L+T L
Sbjct: 61  KSRIDAVIWKGTLSKIEHPPEEGIEFLALGKITTFPGSSKYQIIIESLIPSGSGALMTIL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RKKKL EE LFSD++KNPIPF+PK IAVITSPTGAVIRDILQRISCRFP+RVI+FP K
Sbjct: 121 EERKKKLREEELFSDKYKNPIPFMPKNIAVITSPTGAVIRDILQRISCRFPVRVIVFPAK 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGDECP+EI NAI+QLN LKE   CPRPDIIILARGGGSIEDLWHFNDE IVRAIANSS
Sbjct: 181 VQGDECPREIVNAIIQLNGLKEESICPRPDIIILARGGGSIEDLWHFNDETIVRAIANSS 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IPIISAIGHETDWTL+DYAADLRAPTPTGAAEMAVPVK  L SSL +LE+RLN+ I+RL 
Sbjct: 241 IPIISAIGHETDWTLSDYAADLRAPTPTGAAEMAVPVKHLLTSSLKSLESRLNHSIVRLT 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           K K+N LNSL+K LPNSDQ LSC RY+LDRL RELEHNLEIIIFRK R+FN+ I RIKSD
Sbjct: 301 KNKVNCLNSLIKILPNSDQILSCPRYQLDRLSRELEHNLEIIIFRKCRYFNNTIIRIKSD 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
             +HNIQK RQ+I++KQ++IE  ++Q+LR I L+ ++K  +LHML EQTK+RI  LH HI
Sbjct: 361 VPMHNIQKYRQNIIKKQEYIEHQIEQYLRCIHLKTQQKGTMLHMLCEQTKSRITRLHAHI 420

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           K  I RIE +LS+KI++CHTS+S   RIL+S A++N LKRGY++I+D NNN +T+   L+
Sbjct: 421 KDSINRIELMLSYKIQNCHTSISTPNRILKSLAHRNILKRGYSTIRDLNNNLLTKTNKLS 480

Query: 481 TKTRILINFFDGQANAIVINK----APPKEQPTKKCQLHNNKREKQGTQGELF 529
             T ILI+FF+GQA+AI+ NK     P +++ T+K + ++ K++    QG LF
Sbjct: 481 AGTNILIDFFEGQASAIITNKNHSVLPIEKKYTRKRKDNSQKKKNHEDQGSLF 533


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116250050|ref|YP_765888.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 526 Back     alignment and organism information
>gi|190889943|ref|YP_001976485.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli CIAT 652] Length = 526 Back     alignment and organism information
>gi|222084548|ref|YP_002543077.1| exodeoxyribonuclease VII, large subunit [Agrobacterium radiobacter K84] Length = 571 Back     alignment and organism information
>gi|327191973|gb|EGE58954.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli CNPAF512] Length = 526 Back     alignment and organism information
>gi|241207230|ref|YP_002978326.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 526 Back     alignment and organism information
>gi|150398684|ref|YP_001329151.1| exodeoxyribonuclease VII large subunit [Sinorhizobium medicae WSM419] Length = 526 Back     alignment and organism information
>gi|227824137|ref|YP_002828110.1| exodeoxyribonuclease VII large subunit [Sinorhizobium fredii NGR234] Length = 527 Back     alignment and organism information
>gi|325291705|ref|YP_004277569.1| exodeoxyribonuclease VII large subunit [Agrobacterium sp. H13-3] Length = 534 Back     alignment and organism information
>gi|209551852|ref|YP_002283769.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 527 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target529 exodeoxyribonuclease VII large subunit [Candidatus Libe
PRK00286438 PRK00286, xseA, exodeoxyribonuclease VII large subunit; 1e-136
COG1570440 COG1570, XseA, Exonuclease VII, large subunit [DNA repl 1e-117
TIGR00237432 TIGR00237, xseA, exodeoxyribonuclease VII, large subuni 1e-74
pfam02601295 pfam02601, Exonuc_VII_L, Exonuclease VII, large subunit 5e-60
cd0448978 cd04489, ExoVII_LU_OBF, ExoVII_LU_OBF: A subfamily of O 4e-20
pfam0133675 pfam01336, tRNA_anti, OB-fold nucleic acid binding doma 1e-05
>gnl|CDD|178962 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|31758 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>gnl|CDD|145640 pfam02601, Exonuc_VII_L, Exonuclease VII, large subunit Back     alignment and domain information
>gnl|CDD|72961 cd04489, ExoVII_LU_OBF, ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>gnl|CDD|144799 pfam01336, tRNA_anti, OB-fold nucleic acid binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 529 exodeoxyribonuclease VII large subunit [Candidatus Libe
PRK00286443 xseA exodeoxyribonuclease VII large subunit; Reviewed 100.0
COG1570440 XseA Exonuclease VII, large subunit [DNA replication, r 100.0
TIGR00237441 xseA exodeoxyribonuclease VII, large subunit; InterPro: 100.0
pfam02601295 Exonuc_VII_L Exonuclease VII, large subunit. This famil 100.0
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds co 99.79
pfam0133675 tRNA_anti OB-fold nucleic acid binding domain. This fam 97.91
PRK13480314 3'-5' exoribonuclease YhaM; Provisional 96.76
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds si 96.74
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacteri 96.6
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligonucle 96.38
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds 96.18
PRK07373447 DNA polymerase III subunit alpha; Reviewed 96.02
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds correspondin 95.98
cd0448482 polC_OBF polC_OBF: A subfamily of OB folds correspondin 95.93
cd0448875 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds 95.62
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds simila 95.21
PRK07012 1173 consensus 94.86
COG4085204 Predicted RNA-binding protein, contains TRAM domain [Ge 94.84
COG1571421 Predicted DNA-binding protein containing a Zn-ribbon do 94.0
PRK06752112 single-stranded DNA-binding protein; Validated 93.89
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corr 93.59
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds correspo 93.46
PRK00448 1436 polC DNA polymerase III PolC; Validated 93.12
PRK08763160 single-stranded DNA-binding protein; Provisional 92.95
cd04316108 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, antico 92.77
KOG3108265 consensus 92.46
PRK06751172 single-stranded DNA-binding protein; Provisional 92.4
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 92.01
PRK07274131 single-stranded DNA-binding protein; Provisional 91.5
cd04322108 LysRS_N LysRS_N: N-terminal, anticodon recognition doma 91.41
cd0410085 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodo 91.4
PRK12366649 replication factor A; Reviewed 91.39
COG1200 677 RecG RecG-like helicase [DNA replication, recombination 91.27
cd04317135 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon re 91.0
PRK04036497 DNA polymerase II small subunit; Validated 90.88
PRK09010178 single-stranded DNA-binding protein; Provisional 90.48
PRK06293161 single-stranded DNA-binding protein; Provisional 90.24
pfam00436104 SSB Single-strand binding protein family. This family i 90.09
PRK05733172 single-stranded DNA-binding protein; Provisional 90.07
COG1570440 XseA Exonuclease VII, large subunit [DNA replication, r 97.04
PRK00286443 xseA exodeoxyribonuclease VII large subunit; Reviewed 96.98
TIGR03007510 pepcterm_ChnLen polysaccharide chain length determinant 96.97
PRK05673 1143 dnaE DNA polymerase III subunit alpha; Validated 96.47
PRK05672 1050 dnaE2 error-prone DNA polymerase; Validated 96.13
PRK06826 1157 dnaE DNA polymerase III DnaE; Reviewed 95.92
PRK07279 1033 dnaE DNA polymerase III DnaE; Reviewed 95.3
PRK06658 1145 consensus 95.25
PRK06920 1107 dnaE DNA polymerase III DnaE; Reviewed 95.16
PRK06637 1182 consensus 95.05
PRK11070574 ssDNA exonuclease RecJ; Provisional 93.06
PRK06326 1240 consensus 96.3
PRK06142271 enoyl-CoA hydratase; Provisional 94.31
TIGR02393240 RpoD_Cterm RNA polymerase sigma factor RpoD; InterPro: 94.21
KOG09941758 consensus 91.59
PRK06495257 enoyl-CoA hydratase; Provisional 91.42
PRK09076258 enoyl-CoA hydratase; Provisional 90.95
PRK09245266 enoyl-CoA hydratase; Provisional 90.36
PRK07892 1180 consensus 96.21
PRK09074 1149 consensus 95.97
COG1107715 Archaea-specific RecJ-like exonuclease, contains DnaJ-t 96.19
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 94.39
PRK10917 677 ATP-dependent DNA helicase RecG; Provisional 96.1
PRK08957 1159 consensus 96.01
PRK07374 1171 dnaE DNA polymerase III subunit alpha; Validated 95.06
PRK08744 1195 consensus 93.2
cd04496100 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the 92.9
TIGR021691202 SMC_prok_A chromosome segregation protein SMC; InterPro 95.97
pfam00465312 Fe-ADH Iron-containing alcohol dehydrogenase. 95.36
COG1454377 EutG Alcohol dehydrogenase, class IV [Energy production 93.72
TIGR03405355 Phn_Fe-ADH phosphonate metabolism-associated iron-conta 91.8
PRK10624381 L-1,2-propanediol oxidoreductase; Provisional 91.51
cd06325281 PBP1_ABC_uncharacterized_transporter Type I periplasmic 90.4
PRK09860383 putative alcohol dehydrogenase; Provisional 94.94
PRK09423366 gldA glycerol dehydrogenase; Provisional 94.42
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase WecG/Tag 93.57
pfam03808172 Glyco_tran_WecB Glycosyl transferase WecB/TagA/CpsF fam 93.3
PRK06203390 aroB 3-dehydroquinate synthase; Reviewed 93.16
TIGR01278 562 DPOR_BchB light-independent protochlorophyllide reducta 90.77
pfam01442191 Apolipoprotein Apolipoprotein A1/A4/E domain. These pro 94.39
pfam02601295 Exonuc_VII_L Exonuclease VII, large subunit. This famil 93.22
COG3264 835 Small-conductance mechanosensitive channel [Cell envelo 92.4
PRK05995261 enoyl-CoA hydratase; Provisional 91.38
PRK06143260 enoyl-CoA hydratase; Provisional 90.86
PRK08138260 enoyl-CoA hydratase; Provisional 90.81
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 90.75
PRK06951254 consensus 90.24
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit; InterPro: IPR003753 Exonuclease VII 3 Back     alignment and domain information
>pfam02601 Exonuc_VII_L Exonuclease VII, large subunit Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>pfam01336 tRNA_anti OB-fold nucleic acid binding domain Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC) Back     alignment and domain information
>cd04488 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG Back     alignment and domain information
>cd04483 hOBFC1_like hOBFC1_like: A subfamily of OB folds similar to that found in human OB fold containing protein 1 (hOBFC1) Back     alignment and domain information
>PRK07012 consensus Back     alignment and domain information
>COG4085 Predicted RNA-binding protein, contains TRAM domain [General function prediction only] Back     alignment and domain information
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>PRK06752 single-stranded DNA-binding protein; Validated Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>PRK08763 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS) Back     alignment and domain information
>KOG3108 consensus Back     alignment and domain information
>PRK06751 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK07274 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>cd04322 LysRS_N LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS) Back     alignment and domain information
>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs) Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd04317 EcAspRS_like_N EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND) Helicobacter pylori AspRS Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>PRK09010 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06293 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>pfam00436 SSB Single-strand binding protein family Back     alignment and domain information
>PRK05733 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345 Members of this entry belong to the family of polysaccharide chain length determinant proteins Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK05672 dnaE2 error-prone DNA polymerase; Validated Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK07279 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK06658 consensus Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK06637 consensus Back     alignment and domain information
>PRK11070 ssDNA exonuclease RecJ; Provisional Back     alignment and domain information
>PRK06326 consensus Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD; InterPro: IPR012760 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG0994 consensus Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07892 consensus Back     alignment and domain information
>PRK09074 consensus Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK08957 consensus Back     alignment and domain information
>PRK07374 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK08744 consensus Back     alignment and domain information
>cd04496 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea Back     alignment and domain information
>pfam00465 Fe-ADH Iron-containing alcohol dehydrogenase Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>TIGR03405 Phn_Fe-ADH phosphonate metabolism-associated iron-containing alcohol dehydrogenase Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>pfam03808 Glyco_tran_WecB Glycosyl transferase WecB/TagA/CpsF family Back     alignment and domain information
>PRK06203 aroB 3-dehydroquinate synthase; Reviewed Back     alignment and domain information
>TIGR01278 DPOR_BchB light-independent protochlorophyllide reductase, B subunit; InterPro: IPR005969 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls Back     alignment and domain information
>pfam01442 Apolipoprotein Apolipoprotein A1/A4/E domain Back     alignment and domain information
>pfam02601 Exonuc_VII_L Exonuclease VII, large subunit Back     alignment and domain information
>COG3264 Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06951 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target529 exodeoxyribonuclease VII large subunit [Candidatus Libe
2hpi_A1220 DNA polymerase III alpha subunit; POL-beta-like nucleot 96.61
1v1q_A134 Primosomal replication protein N; primosome, DNA replic 94.96
3f2b_A 1041 DNA-directed DNA polymerase III alpha chain; DNA polyme 94.83
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, DNA 94.57
2fxq_A264 Single-strand binding protein; strand beta-sheet extend 94.49
3e0e_A97 Replication protein A; structural genomics, PSI-2, prot 94.15
1z9f_A153 Single-strand binding protein; TM0604, single stranded 94.05
1txy_A104 Primosomal replication protein N; OB fold, dimer, DNA b 93.83
2vw9_A134 Single-stranded DNA binding protein; DNA replication, s 93.48
1se8_A301 Single-strand binding protein; DNA binding protein; 1.8 92.23
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RAY NES 92.21
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoac 91.14
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 3.24 90.98
1qvc_A145 Single stranded DNA binding protein monomer; beta-barre 90.91
3en2_A101 Probable primosomal replication protein N; PRIB RSR213C 90.47
1o7i_A119 SSB, SSO2364, single stranded DNA binding protein; OB f 90.42
3kf6_A159 Protein STN1; OB fold, chromosomal protein, DNA-binding 96.42
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length RPA14 95.63
3kdf_D132 Replication protein A 32 kDa subunit; wheat GERM cell f 95.18
3bju_A521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- 90.96
3bfj_A387 1,3-propanediol oxidoreductase; opportunistic pathogens 95.71
1vlj_A407 NADH-dependent butanol dehydrogenase; TM0820, structura 95.57
1o2d_A371 Alcohol dehydrogenase, iron-containing; TM0920, structu 95.32
1rrm_A386 Lactaldehyde reductase; structural genomics, dehydrogen 95.24
3hl0_A353 Maleylacetate reductase; structural genomics, PSI-2, pr 94.41
1oj7_A408 Hypothetical oxidoreductase YQHD; structural genomics; 94.3
3jzd_A358 Iron-containing alcohol dehydrogenase; YP_298327.1, put 94.13
2eq5_A228 228AA long hypothetical hydantoin racemase; structural 94.09
1jq5_A370 Glycerol dehydrogenase; oxidoreductase, NAD, glycerol m 91.63
3pea_A261 Enoyl-COA hydratase/isomerase family protein; structura 93.54
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynthetic 92.48
3h02_A288 Naphthoate synthase; IDP00995, lyase, structural genomi 92.22
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HET: CA 92.14
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} 91.69
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, structu 90.76
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clotting; 90.64
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, 90.58
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics center 90.5
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fold, th 90.19
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldol 90.09
3iv7_A364 Alcohol dehydrogenase IV; NP_602249.1, iron-containing 92.83
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 92.67
2zxr_A 666 Single-stranded DNA specific exonuclease RECJ; DNA repa 91.81
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
Probab=96.61  E-value=0.01  Score=42.56  Aligned_cols=53  Identities=13%  Similarity=0.391  Sum_probs=20.1

Q ss_pred             EEEECCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEE
Q ss_conf             99874894799999735210586681459889999996675288437999997101
Q gi|254780791|r   55 FSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIP  110 (529)
Q Consensus        55 f~lkd~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~  110 (529)
                      |+|-|..+.+.|++|...+.+..-.+++|.-|++.|+++   .+++.+++|+.|.+
T Consensus      1068 ~tleD~tG~iev~vF~~~y~~~~~~L~~~~~l~v~G~v~---~~~~~~i~~~~i~~ 1120 (1220)
T 2hpi_A         1068 FTLSDETGALEVVVFGRAYEGVSPKLKEDIPLLVLAEVE---KGEELRVLAQAVWT 1120 (1220)
T ss_dssp             EEEEETTEEEEEC-------------CTTCEEEEEEEEC--------CEEEEEEEE
T ss_pred             EEEEECCCCEEEEECHHHHHHHHHHHCCCCEEEEEEEEE---ECCCEEEEEEECCC
T ss_conf             999989998899983799999988753598799999999---89944899835155



>1v1q_A Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} SCOP: b.40.4.3 PDB: 2ccz_A Back     alignment and structure
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} PDB: 3a5u_A* Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Back     alignment and structure
>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein structure initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Back     alignment and structure
>3en2_A Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Back     alignment and structure
>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 Back     alignment and structure
>3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxane, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics, structural proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural genomics, JCSG, protein structure initiative, PSI; HET: NAP; 1.78A {Thermotoga maritima MSB8} SCOP: e.22.1.2 Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>3hl0_A Maleylacetate reductase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 Back     alignment and structure
>3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha JMP134} Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3h02_A Naphthoate synthase; IDP00995, lyase, structural genomics, center for structural genomics of infectious diseases, csgid; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus HB8} SCOP: c.14.1.3 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium 104} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3iv7_A Alcohol dehydrogenase IV; NP_602249.1, iron-containing alcohol dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target529 exodeoxyribonuclease VII large subunit [Candidatus Libe
d2pi2a1128 Replication protein A 32 KDa subunit (RPA32) fragment { 96.22
d1v1qa_111 Primosomal replication protein N, PriB {Escherichia col 95.28
d1n9wa193 Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, 93.01
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [TaxId: 91.67
d1gm5a2180 RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} 90.74
d3ulla_115 ssDNA-binding protein {Human (Homo sapiens), mitochondr 90.67
d1ue1a_118 ssDNA-binding protein {Mycobacterium tuberculosis [TaxI 90.25
d1e1oa1143 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene l 90.18
d1eova1134 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccha 90.1
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {Thermo 95.65
d1o2da_359 Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxI 95.38
d1rrma_385 Lactaldehyde reductase FucO {Escherichia coli [TaxId: 5 94.58
d1oj7a_390 Hypothetical oxidoreductase yqhD {Escherichia coli [Tax 93.73
d1jq5a_366 Glycerol dehydrogenase {Bacillus stearothermophilus [Ta 92.34
d1ujna_347 Dehydroquinate synthase, DHQS {Thermus thermophilus [Ta 91.09
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [ 91.91
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId 90.3
>d2pi2a1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: Replication protein A 32 KDa subunit (RPA32) fragment
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.22  E-value=0.045  Score=34.57  Aligned_cols=110  Identities=15%  Similarity=0.230  Sum_probs=75.4

Q ss_pred             CCCHHHHHHHHH--H--HHHH-CCCCEEEEEEECCCCCCCCCCEEEEEEECCCC-EEEEEEECCCCCC--CCCCCCCCCE
Q ss_conf             622999999999--9--9740-01718999997054356888627999874894-7999997352105--8668145988
Q gi|254780791|r   14 EYSVSELSYHLK--H--IVES-NLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS-RIDAIIWKGTLNK--IEFLPEEGIE   85 (529)
Q Consensus        14 ~~svs~l~~~i~--~--~l~~-~~~~~~v~gEis~~~~~~~sGH~Yf~lkd~~a-~i~~~~~~~~~~~--~~~~~~~G~~   85 (529)
                      |.|+++|+..-.  .  .+.+ .+..|.+.|-|.+...  .+..+=|+|-|..+ .|.|..|.+....  -.-..++|+-
T Consensus         5 PvtI~ql~~a~~~~~~f~i~g~~v~~V~iVG~V~~i~~--~~t~~~y~idDgTG~~i~v~~w~~~~~~~~~~~~i~~g~y   82 (128)
T d2pi2a1           5 PCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEK--APTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETY   82 (128)
T ss_dssp             ECCHHHHHHCEEETTEEEETTEEESEEEEEEEEEEEEE--CSSEEEEEEECSSSSCEEEEEECC-------CCCCCTTCE
T ss_pred             EEEHHHHHCCCCCCCCEEECCEEEEEEEEEEEEEEEEE--CCCEEEEEEECCCCCCEEEEEECCCCCCCCCCCCCCCCCE
T ss_conf             18999986081789978999999999999999989996--5877999998899994899997888877221430568989


Q ss_pred             EEEEEEEEEECCCCEEEEEEEEEEECC-CCHH-HHHHHHHHHHH
Q ss_conf             999999667528843799999710168-0079-99999999976
Q gi|254780791|r   86 FLVIGKITTFPGSSKYQIIIESLIPSG-SGTL-LTALEKRKKKL  127 (529)
Q Consensus        86 v~~~g~~~~y~~~g~~ql~v~~i~~~g-~G~l-~~~~e~lk~~L  127 (529)
                      |-|.|++..|  +|.-++.+..|.|.- .-++ +-.+|-+...|
T Consensus        83 VrV~G~lk~f--~~~~~i~~~~i~~v~d~Nei~~H~Levi~~hL  124 (128)
T d2pi2a1          83 VKVAGHLRSF--QNKKSLVAFKIMPLEDMNEFTTHILEVINAHM  124 (128)
T ss_dssp             EEEEEEEEEE--TTEEEEEEEEEEECSCTHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEE--CCEEEEEEEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             9999999711--88589999999993796789999999999887



>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e1oa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ujna_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 529 exodeoxyribonuclease VII large subunit [Candidatus
3fho_A_1-326326 (A:1-326) ATP-dependent RNA helicase DBP5; mRNA ex 0.001

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target529 exodeoxyribonuclease VII large subunit [Candidatus Libe
3f2b_A_1-110110 DNA-directed DNA polymerase III alpha chain; DNA p 97.71
1gm5_A_160-24889 RECG; helicase, replication restart; HET: DNA ADP; 96.89
2hpi_A_1024-1128105 DNA polymerase III alpha subunit; POL-beta-like nu 96.74
2pi2_A_270 Replication protein A 32 kDa subunit; FULL-length 96.35
1e1o_A_38-158121 Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synt 96.28
3kdf_D_132 Replication protein A 32 kDa subunit; wheat GERM c 96.26
2kbn_A_109 Conserved protein; nucleic acid binding protein, b 96.08
3e9h_A_1-145145 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 95.78
1n9w_A_1-104104 Aspartyl-tRNA synthetase 2; biosynthetic protein; 95.65
3bju_A_30-156127 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 95.5
3i7f_A_1-161161 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 95.15
1b8a_A_1-108108 Protein (aspartyl-tRNA synthetase); tRNA ligase,; 95.1
1v1q_A_134 Primosomal replication protein N; primosome, DNA r 95.05
1txy_A_104 Primosomal replication protein N; OB fold, dimer, 95.03
3eiv_A_199 Single-stranded DNA-binding protein 2; DNA damage, 94.89
2fxq_A_264 Single-strand binding protein; strand beta-sheet e 94.85
1wyd_A_1-104104 Hypothetical aspartyl-tRNA synthetase; archaea, li 94.54
1c0a_A_1-111111 Aspartyl tRNA synthetase; protein-RNA complex; HET 94.49
1eov_A_1-136136 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 94.49
1x54_A_1-108108 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 94.15
3dm3_A_105 Replication factor A; probably plays AN essential 94.05
2vw9_A_134 Single-stranded DNA binding protein; DNA replicati 93.98
3e0e_A_97 Replication protein A; structural genomics, PSI-2, 93.94
1xjv_A_1-145145 Protection of telomeres 1; protein-DNA complex, si 93.89
3fhw_A_115 Primosomal replication protein N; PRIB BPR162 X-RA 93.79
1x3e_A_165 Single-strand binding protein; oligonucleotide bin 93.73
1z9f_A_153 Single-strand binding protein; TM0604, single stra 93.69
1se8_A_301 Single-strand binding protein; DNA binding protein 92.12
3koj_A_108 Uncharacterized protein YCF41; single-strand bindi 90.69
3kf6_A_159 Protein STN1; OB fold, chromosomal protein, DNA-bi 96.52
2fp4_B_244-395152 Succinyl-COA ligase [GDP-forming] beta-chain, mito 95.19
2nu8_B_238-388151 SCS-beta, succinyl-COA synthetase beta chain; citr 95.12
3ce9_A_1-162162 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 93.73
1jq5_A_1-163163 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 91.98
1oj7_A_27-201175 Hypothetical oxidoreductase YQHD; structural genom 95.13
1ujn_A_1-160160 Dehydroquinate synthase; riken structural genomics 94.74
1o2d_A_1-188188 Alcohol dehydrogenase, iron-containing; TM0920, st 94.32
2h2w_A_312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 93.78
3bfj_A_1-185185 1,3-propanediol oxidoreductase; opportunistic path 93.57
1vlj_A_1-193193 NADH-dependent butanol dehydrogenase; TM0820, stru 92.43
3lft_A_118-235118 Uncharacterized protein; ABC, ATPase, cassette, L- 92.36
3jzd_A_1-161161 Iron-containing alcohol dehydrogenase; YP_298327.1 91.72
1xah_A_1-165165 Sadhqs, 3-dehydroquinate synthase; shikimate pathw 91.15
1o1y_A_239 Conserved hypothetical protein TM1158; structural 90.79
3hl0_A_1-159159 Maleylacetate reductase; structural genomics, PSI- 90.66
2ej5_A_1-199199 Enoyl-COA hydratase subunit II; structural genomic 90.46
>3f2b_A (A:1-110) DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
Probab=97.71  E-value=0.00034  Score=57.07  Aligned_cols=80  Identities=16%  Similarity=0.102  Sum_probs=66.1

Q ss_pred             CCCEEEEEEECCCCCC-CCCCEEE--EEEECCCCEEEEEEECCC--CCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEE
Q ss_conf             1718999997054356-8886279--998748947999997352--1058668145988999999667528843799999
Q gi|254780791|r   32 LSHVCVRGEISGYRGI-HSSGHAY--FSLKDNHSRIDAIIWKGT--LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIE  106 (529)
Q Consensus        32 ~~~~~v~gEis~~~~~-~~sGH~Y--f~lkd~~a~i~~~~~~~~--~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~  106 (529)
                      -..|++.|.|++.+.. .++|+-|  |+|-|..+.|.|++|...  +....-.+++|.-|++.|+++++.-.|.+++.+.
T Consensus        17 ~~~v~i~G~V~~~~~~~tK~G~~~~~~~l~D~tg~ie~~~F~~~~~~~~~~~~l~~g~~v~v~G~v~~~~~~~~~~l~v~   96 (110)
T 3f2b_A           17 ERRVVVQGYVFDAEVSELKSGRTLLTMKITDYTNSILVKMFSRDKEDAELMSGVKKGMWVKVRGSVQNDTFVRDLVIIAN   96 (110)
T ss_dssp             EEEEEEEEEEEEEEEEECTTSCEEEEEEEECSSCEEEEEEECSSHHHHHHHHTCCTTCEEEEEEEEEEETTTTEEEEEEE
T ss_pred             CCEEEEEEEEEEEEEEEECCCCEEEEEEEEECCCCEEEEEECCCCCHHHHHHHCCCCCEEEEEEEEECCCCCCCEEEEEE
T ss_conf             67699999998778787058988999999827886899995587432889850679968999998851577774278721


Q ss_pred             EEEEC
Q ss_conf             71016
Q gi|254780791|r  107 SLIPS  111 (529)
Q Consensus       107 ~i~~~  111 (529)
                      .|.+.
T Consensus        97 ~i~~i  101 (110)
T 3f2b_A           97 DLNEI  101 (110)
T ss_dssp             EEEEE
T ss_pred             EEEEC
T ss_conf             23654



>1gm5_A (A:160-248) RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} Back     alignment and structure
>2hpi_A (A:1024-1128) DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A* Back     alignment and structure
>2pi2_A (A:) Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxane, DNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1e1o_A (A:38-158) Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} Back     alignment and structure
>3kdf_D (D:) Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>2kbn_A (A:) Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A Back     alignment and structure
>3e9h_A (A:1-145) Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm; HET: KAA; 2.10A {Bacillus stearothermophilus} PDB: 3e9i_A* Back     alignment and structure
>1n9w_A (A:1-104) Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} Back     alignment and structure
>3bju_A (A:30-156) Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3i7f_A (A:1-161) Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>1b8a_A (A:1-108) Protein (aspartyl-tRNA synthetase); tRNA ligase,; HET: ATP; 1.90A {Pyrococcus kodakaraensis} Back     alignment and structure
>1v1q_A (A:) Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} Back     alignment and structure
>1txy_A (A:) Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} Back     alignment and structure
>3eiv_A (A:) Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Back     alignment and structure
>2fxq_A (A:) Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>1wyd_A (A:1-104) Hypothetical aspartyl-tRNA synthetase; archaea, ligase; HET: EPE; 2.30A {Sulfolobus tokodaii str} Back     alignment and structure
>1c0a_A (A:1-111) Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} Back     alignment and structure
>1eov_A (A:1-136) ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1x54_A (A:1-108) Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>3dm3_A (A:) Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>2vw9_A (A:) Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Back     alignment and structure
>3e0e_A (A:) Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Back     alignment and structure
>1xjv_A (A:1-145) Protection of telomeres 1; protein-DNA complex, single-stranded DNA, transcription/DNA complex; 1.73A {Homo sapiens} Back     alignment and structure
>3fhw_A (A:) Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein structure initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>1x3e_A (A:) Single-strand binding protein; oligonucleotide binding fold, DNA-binding protein, DNA binding protein; 2.15A {Mycobacterium smegmatis} PDB: 1x3f_A 1x3g_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A Back     alignment and structure
>1z9f_A (A:) Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Back     alignment and structure
>1se8_A (A:) Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} Back     alignment and structure
>3koj_A (A:) Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>3kf6_A (A:) Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2fp4_B (B:244-395) Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} Back     alignment and structure
>2nu8_B (B:238-388) SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, rossmann fold; HET: COA; 2.15A {Escherichia coli} Back     alignment and structure
>3ce9_A (A:1-162) Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate synthase, structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1jq5_A (A:1-163) Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} Back     alignment and structure
>1oj7_A (A:27-201) Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} Back     alignment and structure