255764478

255764478

aminopeptidase protein

GeneID in NCBI database:8209798Locus tag:CLIBASIA_03415
Protein GI in NCBI database:255764478Protein Accession:YP_003065205.2
Gene range:+(467198, 468454)Protein Length:418aa
Gene description:aminopeptidase protein
COG prediction:[E] Leucyl aminopeptidase (aminopeptidase T)
KEGG prediction:aminopeptidase protein; K01269 aminopeptidase [EC:3.4.11.-]
SEED prediction:Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Aminopeptidases (EC 3.4.11.-)
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF
ccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEcccccccccccccccccccccccccccEEEccccccEEEEEEEcccccccccEEccEEEEEEccEEEEEEcccHHHHHHHHHHccccccEEEEEEEEcccccccccccEEEEEEEcccccEEEEccccccccccccccccHHHHHHcccccccEEEEEEEcccEEEEEEEccccEEEEEEccccccc
ccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHccccEEEEEcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEcccccEEEccccccccccEEEcccccccEEEccccccccEEEEcccccccccEEEEEEEEEEEccEEEEEEcccHHHHHHHHHcccccccEccEEEEcccccccccccEEEEEEcccHcHccccccccHHHHHccccccccHHHHHHcccccccEEEEEEEccccEEEccccccccEEEEEEcccccc
MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKaysdntallsisgdnplllvnedsdkVSRVNQAYLKAYKPALERisnfdinwsivpfpscawaeivypddpvpIAIAKLANTIFSVSRAHCIDPIAAWAEhnnflhqksqwlsqrdfaeirfsgpntslkvglaeghrwsggssiaqngimcnpnipteevftapharrvegyatstkplvYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDtlfdenaashiafgqcyskcfkkpdnaldnwleerggnssithidwmigsgdmnvdgltkngvlvpimrggewaf
mdksistvAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEasaskgeemlNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVlvpimrggewaf
MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF
************EFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPL**************QAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF
MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF
****ISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF
MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF
MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target418 aminopeptidase protein [Candidatus Liberibacter asiatic
315122014418 aminopeptidase protein [Candidatus Liberibacter solanac 1 0.0
86355938417 aminopeptidase protein [Rhizobium etli CFN 42] Length = 1 1e-154
190889947417 aminopeptidase [Rhizobium etli CIAT 652] Length = 417 1 1e-153
327191978462 aminopeptidase protein [Rhizobium etli CNPAF512] Length 1 1e-153
15964055418 aminopeptidase protein [Sinorhizobium meliloti 1021] Le 1 1e-153
209551855417 peptidase M29 aminopeptidase II [Rhizobium leguminosaru 1 1e-152
241207232417 peptidase M29 aminopeptidase II [Rhizobium leguminosaru 1 1e-152
116250054417 aminopeptidase [Rhizobium leguminosarum bv. viciae 3841 1 1e-152
307301200418 peptidase M29 aminopeptidase II [Sinorhizobium meliloti 1 1e-152
218463122417 putative aminopeptidase [Rhizobium etli Kim 5] Length = 1 1e-151
>gi|315122014|ref|YP_004062503.1| aminopeptidase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 418 Back     alignment and organism information
 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/418 (81%), Positives = 386/418 (92%)

Query: 1   MDKSISTVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGA 60
           MD SIS++AH+D  LLEKLAKVALQVGV+I+EGQHLIVMAPV ALPL RLIT+HAY LGA
Sbjct: 1   MDNSISSIAHIDVTLLEKLAKVALQVGVHIREGQHLIVMAPVDALPLTRLITQHAYKLGA 60

Query: 61  GLVSVFYKDSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNE 120
           GLVSVFY DSE++LM Y+YGA +AFDR ADWFCEGLAKAY+++TALLSISGD+PLLLVNE
Sbjct: 61  GLVSVFYTDSESSLMRYRYGAPHAFDRSADWFCEGLAKAYTEDTALLSISGDDPLLLVNE 120

Query: 121 DSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANT 180
           D  KVSRVN++YLKAYKP LE+ISNFDINWSI+P+PS AWA++VYP+DP  IA+AKLA  
Sbjct: 121 DPAKVSRVNRSYLKAYKPVLEKISNFDINWSIIPYPSLAWAKVVYPNDPDSIALAKLAKA 180

Query: 181 IFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGG 240
           IF VSR+ C DPI AWAEHNNFLH+KSQWL+Q+DFAEIRFSGPNT LKVGLA+GH+WSGG
Sbjct: 181 IFVVSRSDCADPIIAWAEHNNFLHKKSQWLTQKDFAEIRFSGPNTCLKVGLADGHQWSGG 240

Query: 241 SSIAQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEA 300
           +S A+NGI+CNPNIPTEEVFT PHA++VEGY +STKPLVYQGMLI++IRVRFDQGRVVEA
Sbjct: 241 ASSARNGIICNPNIPTEEVFTTPHAQKVEGYVSSTKPLVYQGMLIDDIRVRFDQGRVVEA 300

Query: 301 SASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCY 360
           SASKGE+MLN+ILDIDEGARRLGEVALVP++SLLSKMNTLFYDTLFDEN+ASHIAFGQCY
Sbjct: 301 SASKGEDMLNRILDIDEGARRLGEVALVPNTSLLSKMNTLFYDTLFDENSASHIAFGQCY 360

Query: 361 SKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF 418
           SKC KKP NA  NW+EERGGNSS+THIDWMIGSGD+NVDGLTK+GVLVPIMR GEW F
Sbjct: 361 SKCLKKPSNASCNWIEERGGNSSMTHIDWMIGSGDINVDGLTKSGVLVPIMREGEWVF 418


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86355938|ref|YP_467830.1| aminopeptidase protein [Rhizobium etli CFN 42] Length = 417 Back     alignment and organism information
>gi|190889947|ref|YP_001976489.1| aminopeptidase [Rhizobium etli CIAT 652] Length = 417 Back     alignment and organism information
>gi|327191978|gb|EGE58959.1| aminopeptidase protein [Rhizobium etli CNPAF512] Length = 462 Back     alignment and organism information
>gi|15964055|ref|NP_384408.1| aminopeptidase protein [Sinorhizobium meliloti 1021] Length = 418 Back     alignment and organism information
>gi|209551855|ref|YP_002283772.1| peptidase M29 aminopeptidase II [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 417 Back     alignment and organism information
>gi|241207232|ref|YP_002978328.1| peptidase M29 aminopeptidase II [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 417 Back     alignment and organism information
>gi|116250054|ref|YP_765892.1| aminopeptidase [Rhizobium leguminosarum bv. viciae 3841] Length = 417 Back     alignment and organism information
>gi|307301200|ref|ZP_07580962.1| peptidase M29 aminopeptidase II [Sinorhizobium meliloti BL225C] Length = 418 Back     alignment and organism information
>gi|218463122|ref|ZP_03503213.1| putative aminopeptidase [Rhizobium etli Kim 5] Length = 417 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target418 aminopeptidase protein [Candidatus Liberibacter asiatic
COG2309385 COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) 1e-98
pfam02073404 pfam02073, Peptidase_M29, Thermophilic metalloprotease 1e-140
>gnl|CDD|32463 COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|145308 pfam02073, Peptidase_M29, Thermophilic metalloprotease (M29) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 418 aminopeptidase protein [Candidatus Liberibacter asiatic
pfam02073404 Peptidase_M29 Thermophilic metalloprotease (M29). 100.0
COG2309385 AmpS Leucyl aminopeptidase (aminopeptidase T) [Amino ac 100.0
pfam10575159 consensus 92.39
PRK02947247 hypothetical protein; Provisional 91.44
>pfam02073 Peptidase_M29 Thermophilic metalloprotease (M29) Back     alignment and domain information
>COG2309 AmpS Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism] Back     alignment and domain information
>pfam10575 consensus Back     alignment and domain information
>PRK02947 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target418 aminopeptidase protein [Candidatus Liberibacter asiatic
2ayi_A408 Wild-Type Ampt From Thermus Thermophilus Length = 4 1e-128
1zjc_A418 Aminopeptidase S From S. Aureus Length = 418 1e-127
gi|83754191|pdb|2AYI|A Chain A, Wild-Type Ampt From Thermus Thermophilus Length = 408 Back     alignment and structure
 Score =  462 bits (1188), Expect = e-128,   Method: Composition-based stats.
 Identities = 193/409 (47%), Positives = 259/409 (63%), Gaps = 4/409 (0%)

Query: 11  VDEFL--LEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYK 68
           +D F   LEKLA++A++VG+N+++GQ +I  AP+ A+   RL+ + AY  GA L +V Y 
Sbjct: 1   MDAFKRNLEKLAELAIRVGLNLEKGQEVIATAPIEAVDFVRLLAEKAYREGASLFTVIYG 60

Query: 69  DSEATLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRV 128
           D E          +   D+   W  EG+A+A+ +  A L++SG +P  L     +KV R 
Sbjct: 61  DQELARKRLALAPEEGLDKAPAWLYEGMARAFREGAARLAVSGSDPKALEGLPPEKVGRA 120

Query: 129 NQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAH 188
            +A  +AYKPALE I+ F  NW+IVPF    WA  V+P  P   A+ +L   IF  +RA 
Sbjct: 121 QKANARAYKPALEAITEFVTNWTIVPFAHPGWARAVFPGLPEEEAVRRLWEAIFQATRAD 180

Query: 189 CIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGI 248
             DPIAAW  HN  LH+K  +L+ R F  + F GP T L VGLAEGH W GG++  + G 
Sbjct: 181 QEDPIAAWEAHNRALHEKVAYLNARRFHALHFKGPGTDLVVGLAEGHLWQGGATATKGGR 240

Query: 249 MCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEM 308
           +CNPN+PTEEVFTAPH  RVEG   +++PL   G L+E I  RF++G  VE  A KGEE+
Sbjct: 241 LCNPNLPTEEVFTAPHRERVEGVVRASRPLALGGTLVEGIFARFERGFAVEVRAEKGEEV 300

Query: 309 LNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPD 368
           L ++LD DEGARRLGEVALVP  + ++K   +F+DTLFDENAASHIAFGQ Y +  +   
Sbjct: 301 LRRLLDTDEGARRLGEVALVPADNPIAKTGLVFFDTLFDENAASHIAFGQAYQENLEGR- 359

Query: 369 NALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWA 417
                   +RGGN S+ H+DWMIGS +M+VDGL ++G   P+MR G W 
Sbjct: 360 -PSGEAFRKRGGNESLVHVDWMIGSEEMDVDGLYEDGTRTPLMRRGRWV 407


>gi|71042332|pdb|1ZJC|A Chain A, Aminopeptidase S From S. Aureus Length = 418 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target418 aminopeptidase protein [Candidatus Liberibacter asiatic
2ayi_A408 Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {T 1e-119
1zjc_A418 Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A 1e-118
>2ayi_A Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {Thermus thermophilus} SCOP: e.60.1.1 Length = 408 Back     alignment and structure
 Score =  422 bits (1087), Expect = e-119
 Identities = 191/405 (47%), Positives = 256/405 (63%), Gaps = 2/405 (0%)

Query: 13  EFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEA 72
           +  LEKLA++A++VG+N+++GQ +I  AP+ A+   RL+ + AY  GA L +V Y D E 
Sbjct: 5   KRNLEKLAELAIRVGLNLEKGQEVIATAPIEAVDFVRLLAEKAYREGASLFTVIYGDQEL 64

Query: 73  TLMLYKYGADYAFDRVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAY 132
                    +   D+   W  EG+A+A+ +  A L++SG +P  L     +KV R  +A 
Sbjct: 65  ARKRLALAPEEGLDKAPAWLYEGMARAFREGAARLAVSGSDPKALEGLPPEKVGRAQKAN 124

Query: 133 LKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDP 192
            +AYKPALE I+ F  NW+IVPF    WA  V+P  P   A+ +L   IF  +RA   DP
Sbjct: 125 ARAYKPALEAITEFVTNWTIVPFAHPGWARAVFPGLPEEEAVRRLWEAIFQATRADQEDP 184

Query: 193 IAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQNGIMCNP 252
           IAAW  HN  LH+K  +L+ R F  + F GP T L VGLAEGH W GG++  + G +CNP
Sbjct: 185 IAAWEAHNRALHEKVAYLNARRFHALHFKGPGTDLVVGLAEGHLWQGGATATKGGRLCNP 244

Query: 253 NIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKI 312
           N+PTEEVFTAPH  RVEG   +++PL   G L+E I  RF++G  VE  A KGEE+L ++
Sbjct: 245 NLPTEEVFTAPHRERVEGVVRASRPLALGGTLVEGIFARFERGFAVEVRAEKGEEVLRRL 304

Query: 313 LDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALD 372
           LD DEGARRLGEVALVP  + ++K   +F+DTLFDENAASHIAFGQ Y +          
Sbjct: 305 LDTDEGARRLGEVALVPADNPIAKTGLVFFDTLFDENAASHIAFGQAYQENL--EGRPSG 362

Query: 373 NWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWA 417
               +RGGN S+ H+DWMIGS +M+VDGL ++G   P+MR G W 
Sbjct: 363 EAFRKRGGNESLVHVDWMIGSEEMDVDGLYEDGTRTPLMRRGRWV 407


>1zjc_A Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A {Staphylococcus aureus subsp} SCOP: e.60.1.1 Length = 418 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target418 aminopeptidase protein [Candidatus Liberibacter asiatic
1zjc_A418 Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A 100.0
2ayi_A408 Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {T 100.0
>1zjc_A Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A {Staphylococcus aureus subsp} SCOP: e.60.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=843.61  Aligned_cols=412  Identities=34%  Similarity=0.579  Sum_probs=401.5

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHCCCHHHH
Q ss_conf             55406999999999999998731347997699981653589999999999982898868987274898997605987898
Q gi|255764478|r    6 STVAHVDEFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAF   85 (418)
Q Consensus         6 ~~~~~m~~~~L~kyA~llV~~~lniqkGe~VlI~~d~~a~~l~ral~~aa~~~GA~~V~v~~~d~~~~r~~~~~a~~e~l   85 (418)
                      |+|+++ +++|+|||+++|++|+||||||+|+|++|.++.||+|+|+++||++||+||.+.|.|+.++|++|.++++++|
T Consensus         2 ~~m~~~-~~~L~k~A~llV~~~l~vq~Ge~VlI~~d~e~~~l~ral~~~ay~~GA~~V~v~~~d~~i~r~~~~~~~~e~l   80 (418)
T 1zjc_A            2 SHMTNY-KEKLQQYAELLVKVGMNVQPKQPVFIRSSVETLELTHLIVEEAYHCGASDVRVVYSDPTLKRLKFENESVEHF   80 (418)
T ss_dssp             ----CH-HHHHHHHHHHHHHTTTCCCTTCCEEEEEETTCHHHHHHHHHHHHHTTCCSEEEEEECHHHHHHHHHHSCHHHH
T ss_pred             CCHHHH-HHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHCCCCHHHH
T ss_conf             960158-9999999999999800589999899996775499999999999986996589842868999998708996684


Q ss_pred             H--HCCHHHHHHHHHHHHCCCEEEEEECCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             6--24336799999998479789998159732430799889998889889998999999845887359996599899987
Q gi|255764478|r   86 D--RVADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEI  163 (418)
Q Consensus        86 ~--~~p~~~~~~~~~~~~~~~a~i~i~~~np~~l~~vd~~ki~~~~~a~~~~~k~~~~~~~~~~~~W~i~~~Pt~awA~~  163 (418)
                      .  .+|.|..+.+.+++++++++|+|.+++|.+++++||+|++++++++.++++.++.+++.++++||++++||++|||+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~a~i~i~~~~p~~l~~vd~~ki~~~~~a~~~~~~~~~~~~~~~~~~W~i~~~Pt~~~A~~  160 (418)
T 1zjc_A           81 ANHEIKSYDVEARMDYVKRGAANLALISEDPDLMDGIDSQKLQAFQQQNARAFKGYMESVQKNQFPWVVAAFPSKAWAKR  160 (418)
T ss_dssp             HHTSSCHHHHHHHHHHHHTTCEEEEEECCCTTTTTTSCHHHHHHHHHHHHHHTHHHHHHHHTTCSCEEEEECCCHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHH
T ss_conf             50031665799999998658857999558963430479789999999999998999999762665469995599899998


Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCCEECCCCCC
Q ss_conf             36899977899999999999974266597999999999999999973016847999976996499995588262278860
Q gi|255764478|r  164 VYPDDPVPIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSI  243 (418)
Q Consensus       164 vfp~~~~~~s~~~l~~~if~a~~~d~~Dpv~~w~~~~~~~~~~~~~Ln~~~~~~i~~~~~gTDLt~~l~~~~~w~~~~~~  243 (418)
                      +||++++++++++||+++|++|++|.+||+++|++|.+.|++++++||+++++.+|++++||||+|+++++|.|.+++++
T Consensus       161 ~~~~l~~eea~~~l~~~if~a~~ld~~dp~~~w~~~~~~l~~~~~~Ln~~~~~~l~~~~~GTDL~~~l~~~~~w~~~~~~  240 (418)
T 1zjc_A          161 VYPELSVEEAYIKFIDEVFDIVRIDGNDPVENWRQHIANLSVYAQKLQQKNYHALHYVSEGTDLTVGLAKNHIWEDATSY  240 (418)
T ss_dssp             HCTTSCHHHHHHHHHHHHHHHTTCSSSCHHHHHHHHHHHHHHHHHHHHHHCCSEEEEEETTEEEEEEECTTBCCBCSEEE
T ss_pred             HCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCEEEECCCCEEECCCCCC
T ss_conf             65899879999999999987851781648999999999999999998640700488216987569980688066178651


Q ss_pred             -CCCCCCCCCCCCCCCEEEEEECCCEEEEEEEEEEEECCCCEECCEEEEEECCEEEEEECCCHHHHHHHHHHCCCCCCEE
Q ss_conf             -2589714686786316951314734189997003303540226869999788999998543799999886428985268
Q gi|255764478|r  244 -AQNGIMCNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRL  322 (418)
Q Consensus       244 -~~~G~~~~~NlP~GEVftaP~~~~vnG~i~~d~p~~~~G~~~~~~~l~f~~G~vv~~~a~~~~~~l~~~l~~d~~a~~i  322 (418)
                       +..+..|++|||+|||||+|+++++||+|++|+|+.+.|++++||+|+||+|+||+++|++++++|++++++||||+||
T Consensus       241 ~~~~~~~~~~NiP~gEvftaP~e~~~~G~i~~~~p~~~~g~~~~~i~l~f~~G~vv~~~~~~~~~~l~~~l~~d~~a~~~  320 (418)
T 1zjc_A          241 VNGKEQAFIANIPTEEVFTAPDRNRVDGYVTNKLPLSYNGTIIDQFKLMFKDGEIIDFSAEKGEAVLKDLINTDEGSRRL  320 (418)
T ss_dssp             GGGTSSEEESBSSCCCEEECEEEEEEEEEEECSSCEEETTEEEEEEEEEEETTEEEEEEEEESHHHHHHHHTSSGGGGSE
T ss_pred             CCCCCCCCCCCCCCCCEEEEEEECCEEEEEEEEEECCCCCEECCCCEEEEECCEEEEEECCCHHHHHHHHHHCCCCCCEE
T ss_conf             35766777587898246842640737899997468163887535828999798899997575489999887259986577


Q ss_pred             EEEEEECCCCCHHHHCCCCCCEEEECCCCCCEECCCCCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCEEEEEEEE
Q ss_conf             79998668620011012003323205752641226775000367667883443206985012458799678819999981
Q gi|255764478|r  323 GEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLT  402 (418)
Q Consensus       323 gE~~ig~n~~~i~~~~~l~~n~L~DEk~~~H~A~G~~y~~~~~~~~~~~~~~~~~~g~n~S~~H~D~~~~~~~i~vdgi~  402 (418)
                      ||||||+||+|+++++++|+|||||||++||||||+|||+|+++|..++++++.++|.|+|++|||+||++++++||||+
T Consensus       321 gE~~ig~n~~~~~~~~~~~~~~L~DEk~t~H~A~G~aY~~~~~~g~~~~~~~~~~~G~N~S~~H~D~v~~~~~~~i~gi~  400 (418)
T 1zjc_A          321 GEVALVPDDSPISNRNTIFYNTLFDENAACHLAIGSAYAFNIQGGTEMTVEEKIASGLNDSNVHVDFMIGSSDLTIYGIF  400 (418)
T ss_dssp             EEEEECCSSSTTGGGCCCCSSHHHHTTTSCEEEEECCCGGGBTTGGGCCHHHHHHHTCCCCSCEEEEECCCTTCEEEEEC
T ss_pred             EEEEEECCCCCCCCCCCCCCCCEEECCCCEEEECCCCCHHHCCCCCCCCHHHHHHCCCCCCCEEEEECCCCCCEEEEEEE
T ss_conf             78875068865554351202305875897557678675200358644673456407884753578773687826789998


Q ss_pred             CCCCEEEEEECCEECC
Q ss_conf             7995999886784549
Q gi|255764478|r  403 KNGVLVPIMRGGEWAF  418 (418)
Q Consensus       403 ~dG~~~~i~~~G~~~~  418 (418)
                      +||+.++|||||+||+
T Consensus       401 ~DG~~~~I~kdG~f~~  416 (418)
T 1zjc_A          401 EDGSKELVFENGNWAS  416 (418)
T ss_dssp             TTSCEEEEEETTEECT
T ss_pred             ECCCEEEEEECCEECC
T ss_conf             2896889999999778



>2ayi_A Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {Thermus thermophilus} SCOP: e.60.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 418 aminopeptidase protein [Candidatus Liberibacter asiatic
d1zjca1413 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococc 1e-119
d2ayia1406 e.60.1.1 (A:3-408) Aminopeptidase T {Thermus thermophil 1e-118
>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1280]} Length = 413 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Thermophilic metalloprotease-like
superfamily: Thermophilic metalloprotease-like
family: Thermophilic metalloprotease (M29)
domain: Aminopeptidase S, AMPS
species: Staphylococcus aureus [TaxId: 1280]
 Score =  423 bits (1089), Expect = e-119
 Identities = 140/405 (34%), Positives = 212/405 (52%), Gaps = 3/405 (0%)

Query: 16  LEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLM 75
           L++ A++ ++VG+N+Q  Q + + + V  L L  LI + AY  GA  V V Y D     +
Sbjct: 6   LQQYAELLVKVGMNVQPKQPVFIRSSVETLELTHLIVEEAYHCGASDVRVVYSDPTLKRL 65

Query: 76  LYKYGADYAFDR--VADWFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYL 133
            ++  +   F    +  +  E          A L++  ++P L+   DS K+    Q   
Sbjct: 66  KFENESVEHFANHEIKSYDVEARMDYVKRGAANLALISEDPDLMDGIDSQKLQAFQQQNA 125

Query: 134 KAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPVPIAIAKLANTIFSVSRAHCIDPI 193
           +A+K  +E +      W +  FPS AWA+ VYP+  V  A  K  + +F + R    DP+
Sbjct: 126 RAFKGYMESVQKNQFPWVVAAFPSKAWAKRVYPELSVEEAYIKFIDEVFDIVRIDGNDPV 185

Query: 194 AAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQ-NGIMCNP 252
             W +H   L   +Q L Q+++  + +    T L VGLA+ H W   +S           
Sbjct: 186 ENWRQHIANLSVYAQKLQQKNYHALHYVSEGTDLTVGLAKNHIWEDATSYVNGKEQAFIA 245

Query: 253 NIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKI 312
           NIPTEEVFTAP   RV+GY T+  PL Y G +I+  ++ F  G +++ SA KGE +L  +
Sbjct: 246 NIPTEEVFTAPDRNRVDGYVTNKLPLSYNGTIIDQFKLMFKDGEIIDFSAEKGEAVLKDL 305

Query: 313 LDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALD 372
           ++ DEG+RRLGEVALVP  S +S  NT+FY+TLFDENAA H+A G  Y+   +       
Sbjct: 306 INTDEGSRRLGEVALVPDDSPISNRNTIFYNTLFDENAACHLAIGSAYAFNIQGGTEMTV 365

Query: 373 NWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWA 417
                 G N S  H+D+MIGS D+ + G+ ++G    +   G WA
Sbjct: 366 EEKIASGLNDSNVHVDFMIGSSDLTIYGIFEDGSKELVFENGNWA 410


>d2ayia1 e.60.1.1 (A:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]} Length = 406 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target418 aminopeptidase protein [Candidatus Liberibacter asiatic
d1zjca1413 Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1 100.0
d2ayia1406 Aminopeptidase T {Thermus thermophilus [TaxId: 274]} 100.0
>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Thermophilic metalloprotease-like
superfamily: Thermophilic metalloprotease-like
family: Thermophilic metalloprotease (M29)
domain: Aminopeptidase S, AMPS
species: Staphylococcus aureus [TaxId: 1280]
Probab=100.00  E-value=0  Score=832.67  Aligned_cols=406  Identities=34%  Similarity=0.584  Sum_probs=397.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHCCCHHHHHH--CCH
Q ss_conf             999999999999873134799769998165358999999999998289886898727489899760598789862--433
Q gi|255764478|r   13 EFLLEKLAKVALQVGVNIQEGQHLIVMAPVSALPLARLITKHAYMLGAGLVSVFYKDSEATLMLYKYGADYAFDR--VAD   90 (418)
Q Consensus        13 ~~~L~kyA~llV~~~lniqkGe~VlI~~d~~a~~l~ral~~aa~~~GA~~V~v~~~d~~~~r~~~~~a~~e~l~~--~p~   90 (418)
                      +++|+|||+++|++|+||||||+|||+++.++.||+|+|+++||++||+||++.|.|+.++|.+|.++++++|..  +|.
T Consensus         3 ~~~L~k~A~llV~~~l~vqkGe~VlI~a~~~~~~lvral~~~a~~aGA~pV~v~~~d~~i~r~~~~~~~~e~l~~~e~~~   82 (413)
T d1zjca1           3 KEKLQQYAELLVKVGMNVQPKQPVFIRSSVETLELTHLIVEEAYHCGASDVRVVYSDPTLKRLKFENESVEHFANHEIKS   82 (413)
T ss_dssp             HHHHHHHHHHHHHTTTCCCTTCCEEEEEETTCHHHHHHHHHHHHHTTCCSEEEEEECHHHHHHHHHHSCHHHHHHTSSCH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCHHHHCCCCCHH
T ss_conf             89999999999998306899998999956743999999999999869964899508789999987189966835320256


Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHCCCCCH
Q ss_conf             67999999984797899981597324307998899988898899989999998458873599965998999873689997
Q gi|255764478|r   91 WFCEGLAKAYSDNTALLSISGDNPLLLVNEDSDKVSRVNQAYLKAYKPALERISNFDINWSIVPFPSCAWAEIVYPDDPV  170 (418)
Q Consensus        91 ~~~~~~~~~~~~~~a~i~i~~~np~~l~~vd~~ki~~~~~a~~~~~k~~~~~~~~~~~~W~i~~~Pt~awA~~vfp~~~~  170 (418)
                      |..+.+.++++..++++++.+++|++|+++||+|++++++++++++++++.+.+.++++||+++|||++|||++||+++.
T Consensus        83 ~~~~~~~~~~~~~~a~i~i~~~~p~~l~~vd~~ki~~~~~a~~~~~k~~~~~~~~~~~~W~i~~~Pt~a~A~~a~~~l~~  162 (413)
T d1zjca1          83 YDVEARMDYVKRGAANLALISEDPDLMDGIDSQKLQAFQQQNARAFKGYMESVQKNQFPWVVAAFPSKAWAKRVYPELSV  162 (413)
T ss_dssp             HHHHHHHHHHHTTCEEEEEECCCTTTTTTSCHHHHHHHHHHHHHHTHHHHHHHHTTCSCEEEEECCCHHHHHHHCTTSCH
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHCCCCCH
T ss_conf             67999999986588489972689524203798999999999999989999998647656699956876777664589987


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCCEECCCCCC-CCCCCC
Q ss_conf             7899999999999974266597999999999999999973016847999976996499995588262278860-258971
Q gi|255764478|r  171 PIAIAKLANTIFSVSRAHCIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSI-AQNGIM  249 (418)
Q Consensus       171 ~~s~~~l~~~if~a~~~d~~Dpv~~w~~~~~~~~~~~~~Ln~~~~~~i~~~~~gTDLt~~l~~~~~w~~~~~~-~~~G~~  249 (418)
                      +|++++||+++|++|++|.+||+++|++|.+.|++++++||+++++.+|++++||||+|+++++|.|.+++++ ++.+..
T Consensus       163 ~e~~~~~~d~if~a~~lD~~dpv~~w~~~~~~l~~~~~~L~~~~~~~~~~~~~gTDLt~~l~~~~~~~~~~~~~~~~~~~  242 (413)
T d1zjca1         163 EEAYIKFIDEVFDIVRIDGNDPVENWRQHIANLSVYAQKLQQKNYHALHYVSEGTDLTVGLAKNHIWEDATSYVNGKEQA  242 (413)
T ss_dssp             HHHHHHHHHHHHHHTTCSSSCHHHHHHHHHHHHHHHHHHHHHHCCSEEEEEETTEEEEEEECTTBCCBCSEEEGGGTSSE
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCEEEECCCCCCCCCCCC
T ss_conf             99999999999975078805179999999999999999985407247994389840799935873771687523677776


Q ss_pred             CCCCCCCCCEEEEEECCCEEEEEEEEEEEECCCCEECCEEEEEECCEEEEEECCCHHHHHHHHHHCCCCCCEEEEEEEEC
Q ss_conf             46867863169513147341899970033035402268699997889999985437999998864289852687999866
Q gi|255764478|r  250 CNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVP  329 (418)
Q Consensus       250 ~~~NlP~GEVftaP~~~~vnG~i~~d~p~~~~G~~~~~~~l~f~~G~vv~~~a~~~~~~l~~~l~~d~~a~~igE~~ig~  329 (418)
                      +.+|||+|||||+|++++|||+|++|+|+.+.|++++||+|+||+|+||+++|++++++|++++++||||+||||||||+
T Consensus       243 ~~~NlP~gEvft~P~~~~~~G~i~~~~~~~~~G~~~~~i~l~f~~G~vv~~~~~~~~~~l~~~l~~d~~a~~~gE~~ig~  322 (413)
T d1zjca1         243 FIANIPTEEVFTAPDRNRVDGYVTNKLPLSYNGTIIDQFKLMFKDGEIIDFSAEKGEAVLKDLINTDEGSRRLGEVALVP  322 (413)
T ss_dssp             EESBSSCCCEEECEEEEEEEEEEECSSCEEETTEEEEEEEEEEETTEEEEEEEEESHHHHHHHHTSSGGGGSEEEEEECC
T ss_pred             CCCCCCCCCEEEEECCCCEEEEEEECEECCCCCEECCCCEEEEECCEEEEEECCCHHHHHHHHHCCCCCCCEEEEEEECC
T ss_conf             64889980068613158613799978252629883248189998999999974765999987640486653676775316


Q ss_pred             CCCCHHHHCCCCCCEEEECCCCCCEECCCCCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCEEEEEEEECCCCEEE
Q ss_conf             86200110120033232057526412267750003676678834432069850124587996788199999817995999
Q gi|255764478|r  330 HSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVP  409 (418)
Q Consensus       330 n~~~i~~~~~l~~n~L~DEk~~~H~A~G~~y~~~~~~~~~~~~~~~~~~g~n~S~~H~D~~~~~~~i~vdgi~~dG~~~~  409 (418)
                      ||+|+++++++|||||||||++||||||+|||+|+.++..++++++..+|.|.|++|||+||++++++||||++||+.++
T Consensus       323 n~~~~~~~~~~~~~~L~DEkgt~H~a~G~~Y~~~~~~~~~~~~~~~~~~G~n~s~~H~D~~i~~~~~~i~gv~~dG~~~~  402 (413)
T d1zjca1         323 DDSPISNRNTIFYNTLFDENAACHLAIGSAYAFNIQGGTEMTVEEKIASGLNDSNVHVDFMIGSSDLTIYGIFEDGSKEL  402 (413)
T ss_dssp             SSSTTGGGCCCCSSHHHHTTTSCEEEEECCCGGGBTTGGGCCHHHHHHHTCCCCSCEEEEECCCTTCEEEEECTTSCEEE
T ss_pred             CCCCCCCCCCCCCCEEEECCCCEEEECCCCCHHHCCCCCCCCHHHHHCCCCCCCCEEEEECCCCCCEEEEEEEECCCEEE
T ss_conf             88654343544245158748974466775642111366557814540179867645787634787156899981897889


Q ss_pred             EEECCEECC
Q ss_conf             886784549
Q gi|255764478|r  410 IMRGGEWAF  418 (418)
Q Consensus       410 i~~~G~~~~  418 (418)
                      |||||+||.
T Consensus       403 I~~~G~f~~  411 (413)
T d1zjca1         403 VFENGNWAS  411 (413)
T ss_dssp             EEETTEECT
T ss_pred             EEECCEECC
T ss_conf             998999767



>d2ayia1 e.60.1.1 (A:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 418 aminopeptidase protein [Candidatus Liberibacter as
1zjc_A_186-418233 (A:186-418) Aminopeptidase AMPS; metallopeptidase, 2e-73
2ayi_A_182-408227 (A:182-408) Aminopeptidase T; metallopeptidase, hy 2e-72
1zjc_A_1-153153 (A:1-153) Aminopeptidase AMPS; metallopeptidase, h 6e-36
2ayi_A_1-148148 (A:1-148) Aminopeptidase T; metallopeptidase, hydr 9e-36
>1zjc_A (A:186-418) Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A {Staphylococcus aureus subsp}Length = 233 Back     alignment and structure
 Score =  270 bits (692), Expect = 2e-73
 Identities = 92/229 (40%), Positives = 130/229 (56%), Gaps = 1/229 (0%)

Query: 191 DPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQ-NGIM 249
           DP+  W +H   L   +Q L Q+++  + +    T L VGLA+ H W   +S        
Sbjct: 3   DPVENWRQHIANLSVYAQKLQQKNYHALHYVSEGTDLTVGLAKNHIWEDATSYVNGKEQA 62

Query: 250 CNPNIPTEEVFTAPHARRVEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEML 309
              NIPTEEVFTAP   RV+GY T+  PL Y G +I+  ++ F  G +++ SA KGE +L
Sbjct: 63  FIANIPTEEVFTAPDRNRVDGYVTNKLPLSYNGTIIDQFKLMFKDGEIIDFSAEKGEAVL 122

Query: 310 NKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFDENAASHIAFGQCYSKCFKKPDN 369
             +++ DEG+RRLGEVALVP  S +S  NT+FY+TLFDENAA H+A G  Y+   +    
Sbjct: 123 KDLINTDEGSRRLGEVALVPDDSPISNRNTIFYNTLFDENAACHLAIGSAYAFNIQGGTE 182

Query: 370 ALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF 418
                    G N S  H+D+MIGS D+ + G+ ++G    +   G WA 
Sbjct: 183 MTVEEKIASGLNDSNVHVDFMIGSSDLTIYGIFEDGSKELVFENGNWAS 231


>2ayi_A (A:182-408) Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {Thermus thermophilus}Length = 227 Back     alignment and structure
>1zjc_A (A:1-153) Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A {Staphylococcus aureus subsp}Length = 153 Back     alignment and structure
>2ayi_A (A:1-148) Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {Thermus thermophilus}Length = 148 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target418 aminopeptidase protein [Candidatus Liberibacter asiatic
1zjc_A_186-418233 Aminopeptidase AMPS; metallopeptidase, hydrolase; 100.0
2ayi_A_182-408227 Aminopeptidase T; metallopeptidase, hydrolase; 3.7 100.0
1zjc_A_1-153153 Aminopeptidase AMPS; metallopeptidase, hydrolase; 100.0
2ayi_A_1-148148 Aminopeptidase T; metallopeptidase, hydrolase; 3.7 100.0
>1zjc_A (A:186-418) Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
Probab=100.00  E-value=0  Score=472.86  Aligned_cols=230  Identities=40%  Similarity=0.693  Sum_probs=223.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEECCCCEECCCCCCCC-CCCCCCCCCCCCCEEEEEECCC
Q ss_conf             659799999999999999997301684799997699649999558826227886025-8971468678631695131473
Q gi|255764478|r  189 CIDPIAAWAEHNNFLHQKSQWLSQRDFAEIRFSGPNTSLKVGLAEGHRWSGGSSIAQ-NGIMCNPNIPTEEVFTAPHARR  267 (418)
Q Consensus       189 ~~Dpv~~w~~~~~~~~~~~~~Ln~~~~~~i~~~~~gTDLt~~l~~~~~w~~~~~~~~-~G~~~~~NlP~GEVftaP~~~~  267 (418)
                      .+||+++|++|.+.+++++++|+++++++||++++||||+|++.+++.|.+++..++ .+..+++|||+|||||+|++++
T Consensus         1 ~~dp~aD~~~~~~~~~~~~~~L~~a~~~~i~~t~~gTDLt~~l~~r~~~~~~g~~~~~~~~~~~~NlP~GEvftaP~~~~   80 (233)
T 1zjc_A            1 GNDPVENWRQHIANLSVYAQKLQQKNYHALHYVSEGTDLTVGLAKNHIWEDATSYVNGKEQAFIANIPTEEVFTAPDRNR   80 (233)
T ss_dssp             SSCHHHHHHHHHHHHHHHHHHHHHHCCSEEEEEETTEEEEEEECTTBCCBCSEEEGGGTSSEEESBSSCCCEEECEEEEE
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCCC
T ss_conf             04069999999999999999986418327998557675698716870661787500577765637789812686122687


Q ss_pred             EEEEEEEEEEEECCCCEECCEEEEEECCEEEEEECCCHHHHHHHHHHCCCCCCEEEEEEEECCCCCHHHHCCCCCCEEEE
Q ss_conf             41899970033035402268699997889999985437999998864289852687999866862001101200332320
Q gi|255764478|r  268 VEGYATSTKPLVYQGMLIENIRVRFDQGRVVEASASKGEEMLNKILDIDEGARRLGEVALVPHSSLLSKMNTLFYDTLFD  347 (418)
Q Consensus       268 vnG~i~~d~p~~~~G~~~~~~~l~f~~G~vv~~~a~~~~~~l~~~l~~d~~a~~igE~~ig~n~~~i~~~~~l~~n~L~D  347 (418)
                      +||+|++|+|+.+.|.+++||+|+||+|+||+++|++++++|+++|++||+++||||||||+||+|++++++++||+|||
T Consensus        81 ~~G~iv~d~~~~~~G~l~~pi~l~ve~G~v~~i~~~~~~~~l~~~l~~d~~a~~igE~giG~N~~a~~~~~~~~~~~L~D  160 (233)
T 1zjc_A           81 VDGYVTNKLPLSYNGTIIDQFKLMFKDGEIIDFSAEKGEAVLKDLINTDEGSRRLGEVALVPDDSPISNRNTIFYNTLFD  160 (233)
T ss_dssp             EEEEEECSSCEEETTEEEEEEEEEEETTEEEEEEEEESHHHHHHHHTSSGGGGSEEEEEECCSSSTTGGGCCCCSSHHHH
T ss_pred             CEEEEEECCCCCCCCEECCCEEEEEECCEEEEEECCCHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCCCCCCEEEE
T ss_conf             02799978113749885037089996988999971776999986541487763775764316886543435442452687


Q ss_pred             CCCCCCEECCCCCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCEEEEEEEECCCCEEEEEECCEECC
Q ss_conf             57526412267750003676678834432069850124587996788199999817995999886784549
Q gi|255764478|r  348 ENAASHIAFGQCYSKCFKKPDNALDNWLEERGGNSSITHIDWMIGSGDMNVDGLTKNGVLVPIMRGGEWAF  418 (418)
Q Consensus       348 Ek~~~H~A~G~~y~~~~~~~~~~~~~~~~~~g~n~S~~H~D~~~~~~~i~vdgi~~dG~~~~i~~~G~~~~  418 (418)
                      ||++||||||++|++|++++..++.+++.++|.|.|++|+|+|+++++|++||+++||+.++|||||+|++
T Consensus       161 Ekgt~HiAlG~~~~~~~~~~~~~~~~~~~~gG~n~s~~H~D~vi~~~~i~idgv~~dG~~~~I~~dG~~~~  231 (233)
T 1zjc_A          161 ENAACHLAIGSAYAFNIQGGTEMTVEEKIASGLNDSNVHVDFMIGSSDLTIYGIFEDGSKELVFENGNWAS  231 (233)
T ss_dssp             TTTSCEEEEECCCGGGBTTGGGCCHHHHHHHTCCCCSCEEEEECCCTTCEEEEECTTSCEEEEEETTEECT
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCCCCEEEEECCCCCCEEEEEEEECCCEEEEEECCEECC
T ss_conf             38965575775641002466557845651089746536888724777156899981897889999999767



>2ayi_A (A:182-408) Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {Thermus thermophilus} Back     alignment and structure
>1zjc_A (A:1-153) Aminopeptidase AMPS; metallopeptidase, hydrolase; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2ayi_A (A:1-148) Aminopeptidase T; metallopeptidase, hydrolase; 3.70A {Thermus thermophilus} Back     alignment and structure