254780793

254780793

integral membrane protein MviN

GeneID in NCBI database:8209799Locus tag:CLIBASIA_03420
Protein GI in NCBI database:254780793Protein Accession:YP_003065206.1
Gene range:-(465354, 466910)Protein Length:518aa
Gene description:integral membrane protein MviN
COG prediction:[R] Uncharacterized membrane protein, putative virulence factor
KEGG prediction:mviN; integral membrane protein MviN; K03980 virulence factor
SEED prediction:hypothetical protein
Pathway involved in KEGG:Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM13 TM-Helix
TOPPRED12 TM-Helix
HMMTOP13 TM-Helix
MEMSAT13 TM-Helix
MEMSAT_SVM14 TM-Helix
PHOBIUS14 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHcHccHHccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcc
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAegifhnsfiplfsqekenngsesaqRLSSEIFSILILSLVVLTVVVELILPLLIRFiiapgfadqsdkYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYfiasiapiviNVFPIFALTYalwhpsspqetTYLLAWGVFLSNVVHFWIVYCCakndgvklrfqyprlthnVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIyslpvgviGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYergafssqntILVSSFLSIYSIGILANILSKSLSTAFYaqndmkapmKFTIVSIAINLTIaigsfpfigGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRpyfnqfssattffdpfKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRlsseifsililslvvltvvvelilplliRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
*KIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEK******SAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSR************LQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQE**********RLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMI**
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK
MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target518 integral membrane protein MviN [Candidatus Liberibacter
315122015519 integral membrane protein MviN [Candidatus Liberibacter 1 1e-169
209547641528 integral membrane protein MviN [Rhizobium leguminosarum 1 1e-121
116250173526 transmembrane mviN virulence factor homologue [Rhizobiu 1 1e-118
241202798526 integral membrane protein MviN [Rhizobium leguminosarum 1 1e-118
190890056526 virulence factor transmembrane protein [Rhizobium etli 1 1e-116
327188579526 virulence factor transmembrane protein [Rhizobium etli 1 1e-116
222084683533 integral membrane protein MviN [Agrobacterium radiobact 1 1e-115
7387908533 RecName: Full=Virulence factor mviN homolog Length = 53 1 1e-113
86356043526 virulence factor transmembrane protein [Rhizobium etli 1 1e-112
222147342532 integral membrane protein MviN [Agrobacterium vitis S4] 1 1e-111
>gi|315122015|ref|YP_004062504.1| integral membrane protein MviN [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 519 Back     alignment and organism information
 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 317/519 (61%), Positives = 413/519 (79%), Gaps = 1/519 (0%)

Query: 1   MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIF 60
           MKIIRNF TV  S LGSR LGFIRETL+A+TLG+G VTD F +AF L F+FRRL AEG F
Sbjct: 1   MKIIRNFFTVGTSILGSRILGFIRETLMASTLGIGAVTDAFVIAFSLPFLFRRLVAEGAF 60

Query: 61  HNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFAD 120
           HNSF+PLFS EKE NG+E AQRLSSEI+S+L+  +VVLT+VVEL LPLLI F+IAPGF+ 
Sbjct: 61  HNSFVPLFSHEKELNGTEGAQRLSSEIWSVLLTIVVVLTIVVELSLPLLIHFVIAPGFSY 120

Query: 121 QSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYAL 180
           QS +Y+LTIQLS+++FPSIIFI+L +L+TG L+ALG YF+ASI P+ +N+  I  LTYAL
Sbjct: 121 QSPEYYLTIQLSQIIFPSIIFIALTALITGALYALGHYFVASITPVFLNIPSIIVLTYAL 180

Query: 181 WHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPL 240
            + S PQ+T Y ++ G+ L++++  W  Y   +  G+K+RFQYPRLT NV+ FLKLTFPL
Sbjct: 181 LNNSKPQDTVYFISCGMTLASIIQLWATYYYIRRSGIKIRFQYPRLTDNVRKFLKLTFPL 240

Query: 241 MVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRS 300
           + TG IIQI++I+GRA+A++E G+ SA+QYA+R Y LP+ +IG AM +V+LP LSR+L+S
Sbjct: 241 IFTGTIIQINSIIGRALATKEFGLASALQYADRTYQLPIAIIGVAMGLVVLPELSRALKS 300

Query: 301 KNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIY 360
           K+K  +F LQNQAIEC+ F  IP+ + L++LSKEI+QTLYERGAF+ +NTI VSS +SIY
Sbjct: 301 KDKSTTFTLQNQAIECVLFLSIPAFIILYILSKEIIQTLYERGAFTHENTIFVSSIISIY 360

Query: 361 SIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSS 420
           SIGI+A ILSK+L T FYA+ +MK PM FT++SIA++  I+I SFPFIGGYGIA AEV+S
Sbjct: 361 SIGIIAFILSKTLQTIFYARKNMKTPMHFTLISIAVSCVISIVSFPFIGGYGIACAEVAS 420

Query: 421 SWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPY-FNQFSSATTFF 479
            WVN I L +TLL+RKQ+ LP +TIYRILS+ IS+GLMG FIIL +PY F+  +   TF 
Sbjct: 421 GWVNAILLTVTLLRRKQLFLPMETIYRILSIFISSGLMGAFIILSKPYFFSNIAIEQTFV 480

Query: 480 DPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK 518
             F +L  +LS A+LVYL SI LF+GK ++S  ++M++K
Sbjct: 481 SQFTSLFAILSCAVLVYLSSIALFIGKKYVSSFKKMMKK 519


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209547641|ref|YP_002279558.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 528 Back     alignment and organism information
>gi|116250173|ref|YP_766011.1| transmembrane mviN virulence factor homologue [Rhizobium leguminosarum bv. viciae 3841] Length = 526 Back     alignment and organism information
>gi|241202798|ref|YP_002973894.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 526 Back     alignment and organism information
>gi|190890056|ref|YP_001976598.1| virulence factor transmembrane protein [Rhizobium etli CIAT 652] Length = 526 Back     alignment and organism information
>gi|327188579|gb|EGE55789.1| virulence factor transmembrane protein [Rhizobium etli CNPAF512] Length = 526 Back     alignment and organism information
>gi|222084683|ref|YP_002543212.1| integral membrane protein MviN [Agrobacterium radiobacter K84] Length = 533 Back     alignment and organism information
>gi|7387908|sp|O05467|MVIN_RHITR RecName: Full=Virulence factor mviN homolog Length = 533 Back     alignment and organism information
>gi|86356043|ref|YP_467935.1| virulence factor transmembrane protein [Rhizobium etli CFN 42] Length = 526 Back     alignment and organism information
>gi|222147342|ref|YP_002548299.1| integral membrane protein MviN [Agrobacterium vitis S4] Length = 532 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target518 integral membrane protein MviN [Candidatus Liberibacter
TIGR01695502 TIGR01695, mviN, integral membrane protein MviN 1e-73
COG2244480 COG2244, RfbX, Membrane protein involved in the export 7e-05
COG0728518 COG0728, MviN, Uncharacterized membrane protein, putati 1e-75
pfam03023452 pfam03023, MVIN, MviN-like protein 1e-67
COG0534 455 COG0534, NorM, Na+-driven multidrug efflux pump [Defens 4e-07
COG0534455 COG0534, NorM, Na+-driven multidrug efflux pump [Defens 8e-04
TIGR00797342 TIGR00797, matE, putative efflux protein, MATE family 0.003
>gnl|CDD|162493 TIGR01695, mviN, integral membrane protein MviN Back     alignment and domain information
>gnl|CDD|32425 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|31072 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>gnl|CDD|111867 pfam03023, MVIN, MviN-like protein Back     alignment and domain information
>gnl|CDD|30880 COG0534, NorM, Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|30880 COG0534, NorM, Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|162043 TIGR00797, matE, putative efflux protein, MATE family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 518 integral membrane protein MviN [Candidatus Liberibacter
TIGR01695538 mviN integral membrane protein MviN; InterPro: IPR00426 100.0
COG0728518 MviN Uncharacterized membrane protein, putative virulen 100.0
TIGR02900493 spore_V_B stage V sporulation protein B; InterPro: IPR0 100.0
PRK10459492 colanic acid exporter; Provisional 100.0
pfam03023452 MVIN MviN-like protein. Deletion of the mviN virulence 100.0
PRK09575456 vmrA multidrug efflux pump VmrA; Reviewed 100.0
COG2244480 RfbX Membrane protein involved in the export of O-antig 100.0
PRK01766452 multidrug efflux protein; Reviewed 100.0
COG0534455 NorM Na+-driven multidrug efflux pump [Defense mechanis 100.0
PRK10189481 hypothetical protein; Provisional 100.0
PRK00187462 multidrug efflux protein NorA; Provisional 100.0
PRK10367439 DNA-damage-inducible SOS response protein; Provisional 100.0
TIGR00797412 matE MATE efflux family protein; InterPro: IPR002528 Ch 100.0
KOG2864530 consensus 99.66
KOG1347473 consensus 99.47
PRK10189 481 hypothetical protein; Provisional 99.97
PRK01766 452 multidrug efflux protein; Reviewed 99.97
COG0534 455 NorM Na+-driven multidrug efflux pump [Defense mechanis 99.97
PRK09575 456 vmrA multidrug efflux pump VmrA; Reviewed 99.97
TIGR00797 412 matE MATE efflux family protein; InterPro: IPR002528 Ch 99.96
PRK00187 462 multidrug efflux protein NorA; Provisional 99.95
PRK10367 439 DNA-damage-inducible SOS response protein; Provisional 99.95
TIGR02900 493 spore_V_B stage V sporulation protein B; InterPro: IPR0 99.56
KOG1347 473 consensus 99.47
pfam01943272 Polysacc_synt Polysaccharide biosynthesis protein. Memb 98.1
pfam01943272 Polysacc_synt Polysaccharide biosynthesis protein. Memb 99.89
pfam03023452 MVIN MviN-like protein. Deletion of the mviN virulence 99.78
PRK10459492 colanic acid exporter; Provisional 99.6
COG0728518 MviN Uncharacterized membrane protein, putative virulen 99.57
TIGR01695538 mviN integral membrane protein MviN; InterPro: IPR00426 99.52
pfam01554161 MatE MatE. The MatE domain 99.78
pfam04506533 Rft-1 Rft protein. 99.67
pfam01554161 MatE MatE. The MatE domain 99.59
COG2244480 RfbX Membrane protein involved in the export of O-antig 99.35
COG4267467 Predicted membrane protein [Function unknown] 97.3
pfam04506533 Rft-1 Rft protein. 97.16
KOG2864530 consensus 96.68
TIGR01478315 STEVOR variant surface antigen, stevor family; InterPro 90.33
>TIGR01695 mviN integral membrane protein MviN; InterPro: IPR004268 The sequencing of a number of pathogenic bacterial genomes has led to novel virulence proteins being discovered that are yet to be biochemically characterised Back     alignment and domain information
>COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>TIGR02900 spore_V_B stage V sporulation protein B; InterPro: IPR014249 This entry represents SpoVB, which is the stage V sporulation protein B of the bacterial endospore formation program in Bacillus subtilis and various other Firmcutes Back     alignment and domain information
>PRK10459 colanic acid exporter; Provisional Back     alignment and domain information
>pfam03023 MVIN MviN-like protein Back     alignment and domain information
>PRK09575 vmrA multidrug efflux pump VmrA; Reviewed Back     alignment and domain information
>COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>PRK01766 multidrug efflux protein; Reviewed Back     alignment and domain information
>COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK10189 hypothetical protein; Provisional Back     alignment and domain information
>PRK00187 multidrug efflux protein NorA; Provisional Back     alignment and domain information
>PRK10367 DNA-damage-inducible SOS response protein; Provisional Back     alignment and domain information
>TIGR00797 matE MATE efflux family protein; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters Back     alignment and domain information
>KOG2864 consensus Back     alignment and domain information
>KOG1347 consensus Back     alignment and domain information
>PRK10189 hypothetical protein; Provisional Back     alignment and domain information
>PRK01766 multidrug efflux protein; Reviewed Back     alignment and domain information
>COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK09575 vmrA multidrug efflux pump VmrA; Reviewed Back     alignment and domain information
>TIGR00797 matE MATE efflux family protein; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters Back     alignment and domain information
>PRK00187 multidrug efflux protein NorA; Provisional Back     alignment and domain information
>PRK10367 DNA-damage-inducible SOS response protein; Provisional Back     alignment and domain information
>TIGR02900 spore_V_B stage V sporulation protein B; InterPro: IPR014249 This entry represents SpoVB, which is the stage V sporulation protein B of the bacterial endospore formation program in Bacillus subtilis and various other Firmcutes Back     alignment and domain information
>KOG1347 consensus Back     alignment and domain information
>pfam01943 Polysacc_synt Polysaccharide biosynthesis protein Back     alignment and domain information
>pfam01943 Polysacc_synt Polysaccharide biosynthesis protein Back     alignment and domain information
>pfam03023 MVIN MviN-like protein Back     alignment and domain information
>PRK10459 colanic acid exporter; Provisional Back     alignment and domain information
>COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>TIGR01695 mviN integral membrane protein MviN; InterPro: IPR004268 The sequencing of a number of pathogenic bacterial genomes has led to novel virulence proteins being discovered that are yet to be biochemically characterised Back     alignment and domain information
>pfam01554 MatE MatE Back     alignment and domain information
>pfam04506 Rft-1 Rft protein Back     alignment and domain information
>pfam01554 MatE MatE Back     alignment and domain information
>COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>COG4267 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam04506 Rft-1 Rft protein Back     alignment and domain information
>KOG2864 consensus Back     alignment and domain information
>TIGR01478 STEVOR variant surface antigen, stevor family; InterPro: IPR006374 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target518 integral membrane protein MviN [Candidatus Liberibacter
3mkt_A460 Multi antimicrobial extrusion protein (Na(+)/drug antip 100.0
3mkt_A 460 Multi antimicrobial extrusion protein (Na(+)/drug antip 99.9
>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A Back     alignment and structure
Probab=100.00  E-value=3.1e-41  Score=233.02  Aligned_cols=418  Identities=11%  Similarity=0.045  Sum_probs=330.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             13688999999999999999999999999957775789999999978999999975778999999999998448978999
Q gi|254780793|r    2 KIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQ   81 (518)
Q Consensus         2 ~~~k~~~~~~~~~~~skilG~~r~~~~a~~~G~~~~~da~~~a~~i~~~~~~l~~~G~~~~a~ip~~~~~~~~~~~~~~~   81 (518)
                      ++.|-+...++..+...+.|++....+++ +|+.+.+ +...+.++.++...+. . +++.+..+..+|+.+++|+|+++
T Consensus        13 ~l~~la~P~~~~~l~~~~~~~vD~~~vg~-lg~~~la-av~~~~~i~~~~~~~~-~-gl~~g~~~lvaq~~G~~~~~~~~   88 (460)
T 3mkt_A           13 NLIKLATPVLIASVAQTGMGFVDTIMAGG-VSAIDMA-AVSIAASIWLPSILFG-V-GLLMALVPVVAQLNGAGRQHKIP   88 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTHHH-HTTTTSS-HHHHHHHHHHHHHHHH-H-HHHHHHGGGCTTTTSSSSTTTHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCHHHHH-HHHHHHHHHHHHHHHH-H-HHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99999999999999999999999999875-2889999-9999999999999999-9-99999999999997399989999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             99999999999999999999999653434445788754101111245655444332124688876568899884222799
Q gi|254780793|r   82 RLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIA  161 (518)
Q Consensus        82 ~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~l~a~g~~~~~~~~~la~~~~~i~~p~~~~~~~~~~~~~~l~~~~~f~~~  161 (518)
                      +..++.+....+.+..+. +.+.+.|++...+.     .+++..+.+..+.++..|..++..+....++++|+.++.+++
T Consensus        89 ~~~~~~l~~~~~~~i~~~-~~~~~~~~i~~~~~-----~~~~~~~~a~~Y~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~  162 (460)
T 3mkt_A           89 FEVHQGLILALLVSVPII-AVLFQTQFIIRFMD-----VEEAMATKTVGYMHAVIFAVPAYLLFQALRSFTDGMSLTKPA  162 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHH-HHHHHHHTTCSSCS-----STTHHHHHHHHHHTTGGGHHHHHHHHHHHTTTTCTTSCCTTT
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHC-----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHH
T ss_conf             999999999999999888-99866999999962-----539999998764030100131267889987652045455315


Q ss_pred             HHHHHHHHCHHHHHHHHHH-CCCCCCCCCCEEHHHHHHHHHHHHHCCCCCH-HHCCC----CCCCCCCCCCCCCCCHHHH
Q ss_conf             9999854010346777762-3568654432000122111011100023101-21036----5444567754324100013
Q gi|254780793|r  162 SIAPIVINVFPIFALTYAL-WHPSSPQETTYLLAWGVFLSNVVHFWIVYCC-AKNDG----VKLRFQYPRLTHNVKFFLK  235 (518)
Q Consensus       162 a~~~vi~ni~~i~~~~~~~-~~~~~~~~~~~~~a~~~~~g~~~~~~~~~~~-~~~~~----~~~~~~~~~~~~~~k~~l~  235 (518)
                      ...++..++.++....... .....+..++.+.++++..+........... .++..    ...+..++...+..|++.+
T Consensus       163 ~~~~i~~~i~ni~l~~~li~g~~~~~~~~~~G~a~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  242 (460)
T 3mkt_A          163 MVIGFIGLLLNIPLNWIFVYGKFGAPELGGVGCGVATAIVYWIMLLLLLFYIVTSKRLAHVKVFETFHKPQPKELIRLFR  242 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCCCSCCCCSSTTSSTTTSHH
T ss_pred             HHHHHHCCCCEEECCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHHHHHCCC
T ss_conf             76432113321221441011465566510789999988889998544677755300111112102102214566542133


Q ss_pred             HHHHHHHHHHHCCCHHHHHCCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             468887643201202333202556-5566305777753321100000011123221002344443322367899989754
Q gi|254780793|r  236 LTFPLMVTGGIIQISNIVGRAIAS-RETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAI  314 (518)
Q Consensus       236 ~~~p~~l~~~~~~i~~~i~~~~as-~~~g~vs~~~~a~~l~~l~~~i~~~ai~~~~~P~ls~~~~~~d~~~~~~~~~~~~  314 (518)
                      .+.|..+..........+.+.+.+ .++.++++++.+.++.++.. .+..+++++.-|.+++++++||.++.++..++++
T Consensus       243 ~~~p~~~~~~~~~~~~~~~~~~~~~~g~~~~aa~~i~~~i~~~~~-~~~~~l~~a~~~~vg~~~G~~~~~~~~~~~~~~~  321 (460)
T 3mkt_A          243 LGFPVAAALFFEVTLFAVVALLVAPLGSTVVAAHQVALNFSSLVF-MFPMSIGAAVSIRVGHKLGEQDTKGAAIAANVGL  321 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTCTTSSHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHSSCCCTTTTHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             578278899999999999999987268712259899999999999-9999999999999999872776899999999999


Q ss_pred             HCCCCCHHHHHHHHHHCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11344215899999852572311121047864455456666555420105677531232023544331013467778886
Q gi|254780793|r  315 ECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSI  394 (518)
Q Consensus       315 ~~~~~i~~p~~~~l~~~~~~ii~llf~~g~F~~~~~~~~~~~L~~~~~~~~~~~~~~i~~~~~~a~g~~~~~~~~~~~~~  394 (518)
                      +.....+++.+..++.+++++.. +|..   |++..+.....+.+++++.++.+.+......+++.||++.++..++++.
T Consensus       322 ~~~~~~~~~~~~l~~~~~~~i~~-~f~~---d~~~~~~~~~~l~~~~l~~~~~~~~~~~~~~l~g~g~~~~~~~~~~~~~  397 (460)
T 3mkt_A          322 MTGLATACITALLTVLFREQIAL-LYTE---NQVVVALAMQLLLFAAIYQCMDAVQVVAAGSLRGYKDMTAIFHRTFISY  397 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHT-CSSC---CSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGSTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH-HCCC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             84489999999999999999986-2689---8999999999999999999999999999999998674899999999999


Q ss_pred             -HHHHHHHHHHC-------CCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -89999987520-------21120049999999999999999999997
Q gi|254780793|r  395 -AINLTIAIGSF-------PFIGGYGIALAEVSSSWVNTICLAITLLK  434 (518)
Q Consensus       395 -~vni~l~~~li-------~~~G~~G~a~at~i~~~~~~~~~~~~l~k  434 (518)
                       ++.+++.+++.       +.+|..|++++..+++.+.++++.+.+++
T Consensus       398 ~~i~ip~~~~l~~~~~~~~~~~G~~Giw~~~~~~~~~~~~~~~~~l~~  445 (460)
T 3mkt_A          398 WVLGLPTGYILGMTNWLTEQPLGAKGFWLGFIIGLSAAALMLGQRLYW  445 (460)
T ss_dssp             HHHHHHHHHHHHHHHTSSCCSSHHHHHHHHHHHHHHHHHHHHHSSSSS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999998523524469999999999999999999999999



>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00