254780794

254780794

tryptophanyl-tRNA synthetase

GeneID in NCBI database:8209800Locus tag:CLIBASIA_03425
Protein GI in NCBI database:254780794Protein Accession:YP_003065207.1
Gene range:-(464211, 465278)Protein Length:355aa
Gene description:tryptophanyl-tRNA synthetase
COG prediction:[J] Tryptophanyl-tRNA synthetase
KEGG prediction:trpS; tryptophanyl-tRNA synthetase (EC:6.1.1.2); K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2]
SEED prediction:Tryptophanyl-tRNA synthetase (EC 6.1.1.2)
Pathway involved in KEGG:Tryptophan metabolism [PATH:las00380]
Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Trp
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
ccccccEEEEccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccEEEccccccccccHHHHHHHHHHHHHHHcccccccEEEEcHHHHccccccHHHHHHHHHHHHHHHHHccccccccEEEEHHHccHHHHHHHHHHHHccHHHHHccHHHHHHHHccccccccHHHHcHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHHHHHHHHcHHHHHcccEEEcccccccccccccEEEccccccccEcccccccEcccccccHHHccEccccHHHHHHHHHccccccccccEEEccccccccHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mlssdnlfvsgvqptgvlhlgNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLaagvdpsrniifkqsdvgyhaDLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRathvpvgedqrQHLEITRLIAQRFNTEFERKIKEVAQKYAQEeqyskgffpIIEGLIDSSASRIRSLRDASkkmsksdssdfsrinlldnpDIIAKKIQKAktdgdvlpsevsgleNRLEAKNLIEIFATMRQIKIEEALKqfggknfsQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDaskkmsksdssdfsrinlldnpdIIAKKIQkaktdgdvlpsevsglenrleAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKyvneivglsh
MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRdaskkmsksdssdfsRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
***SDNL**SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKE*S******TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRS*****************RINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFK********ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIR****************FSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
****DNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target355 tryptophanyl-tRNA synthetase [Candidatus Liberibacter a
254780622405 bifunctional phosphopantothenoylcysteine decarboxy 0.018
>gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Back     alignment
 Score = 32.0 bits (71), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 195 FPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
            P+   ++ S+ S  R  + A  K+ + D  D  RI+L++NPDI+
Sbjct: 269 LPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDIL 313

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target355 tryptophanyl-tRNA synthetase [Candidatus Liberibacter a
315122016354 tryptophanyl-tRNA synthetase [Candidatus Liberibacter s 1 1e-156
13474436355 tryptophanyl-tRNA synthetase [Mesorhizobium loti MAFF30 1 1e-106
260462742355 tryptophanyl-tRNA synthetase [Mesorhizobium opportunist 1 1e-105
319779937355 tryptophanyl-tRNA synthetase [Mesorhizobium ciceri biov 1 1e-102
90420548355 tryptophanyl-tRNA synthetase [Aurantimonas manganoxydan 1 1e-102
110636359355 tryptophanyl-tRNA synthetase [Mesorhizobium sp. BNC1] L 1 1e-102
222084686354 tryptophanyl-tRNA synthetase protein [Agrobacterium rad 1 1e-102
222147344354 tryptophanyl-tRNA synthetase [Agrobacterium vitis S4] L 1 1e-102
150395262354 tryptophanyl-tRNA synthetase [Sinorhizobium medicae WSM 1 1e-101
227820622354 tryptophanyl-tRNA synthetase [Sinorhizobium fredii NGR2 1 1e-101
>gi|315122016|ref|YP_004062505.1| tryptophanyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 354 Back     alignment and organism information
 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/355 (74%), Positives = 313/355 (88%), Gaps = 1/355 (0%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M SS+NLFVSGVQPTG LHLGNYLGMIR V++RQ+TCN  G+YF+ADLHAITN +VQE+L
Sbjct: 1   MNSSENLFVSGVQPTGGLHLGNYLGMIRKVVKRQQTCNWAGIYFVADLHAITNKVVQEDL 60

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
             QSRL +ASFLAAG+DPSRNI+FKQS V  H++L+WILSC+ARMGWMNNMIQFKEKS +
Sbjct: 61  PDQSRLVIASFLAAGIDPSRNIMFKQSAVSEHSELAWILSCIARMGWMNNMIQFKEKSGK 120

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + E TASLGL+ YPVLMAADILLYRATHVPVGEDQ+QHLE+TRLIAQRFN EFE +IK++
Sbjct: 121 DGE-TASLGLYSYPVLMAADILLYRATHVPVGEDQKQHLELTRLIAQRFNAEFEHQIKKI 179

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
           +Q    +EQYSKGFFPIIE LI+SS SRI+SL++ASKKMSKSD ++ SRI+LLD+ D IA
Sbjct: 180 SQASQNKEQYSKGFFPIIESLIESSTSRIKSLKNASKKMSKSDPANSSRIDLLDDADTIA 239

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           KKIQKAKTDGDVLPSEVSGLENRLEAKNL++IFAT++ IK EE LKQFGGK FSQFKLAL
Sbjct: 240 KKIQKAKTDGDVLPSEVSGLENRLEAKNLVDIFATIKHIKPEEVLKQFGGKYFSQFKLAL 299

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           A+ +I EI PIS ++  LLK+KSY+D IL++GANRAR RAQ+TM++V EIVG SH
Sbjct: 300 AEVIIAEIKPISTEMHRLLKEKSYIDDILIKGANRARYRAQKTMRHVREIVGFSH 354


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|13474436|ref|NP_106004.1| tryptophanyl-tRNA synthetase [Mesorhizobium loti MAFF303099] Length = 355 Back     alignment and organism information
>gi|260462742|ref|ZP_05810947.1| tryptophanyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075] Length = 355 Back     alignment and organism information
>gi|319779937|ref|YP_004139413.1| tryptophanyl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 355 Back     alignment and organism information
>gi|90420548|ref|ZP_01228455.1| tryptophanyl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1] Length = 355 Back     alignment and organism information
>gi|110636359|ref|YP_676567.1| tryptophanyl-tRNA synthetase [Mesorhizobium sp. BNC1] Length = 355 Back     alignment and organism information
>gi|222084686|ref|YP_002543215.1| tryptophanyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 354 Back     alignment and organism information
>gi|222147344|ref|YP_002548301.1| tryptophanyl-tRNA synthetase [Agrobacterium vitis S4] Length = 354 Back     alignment and organism information
>gi|150395262|ref|YP_001325729.1| tryptophanyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 354 Back     alignment and organism information
>gi|227820622|ref|YP_002824592.1| tryptophanyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 354 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 tryptophanyl-tRNA synthetase [Candidatus Liberibacter a
PRK00927333 PRK00927, PRK00927, tryptophanyl-tRNA synthetase; Revie 1e-125
PLN02886389 PLN02886, PLN02886, aminoacyl-tRNA ligase 5e-96
COG0180314 COG0180, TrpS, Tryptophanyl-tRNA synthetase [Translatio 1e-78
TIGR00233328 TIGR00233, trpS, tryptophanyl-tRNA synthetase 4e-67
PRK12556332 PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provi 2e-56
PRK12282333 PRK12282, PRK12282, tryptophanyl-tRNA synthetase II; Re 3e-52
PRK12284431 PRK12284, PRK12284, tryptophanyl-tRNA synthetase; Revie 6e-47
KOG2713347 KOG2713, KOG2713, KOG2713, Mitochondrial tryptophanyl-t 1e-91
cd00806280 cd00806, TrpRS_core, catalytic core domain of tryptopha 3e-75
pfam00579291 pfam00579, tRNA-synt_1b, tRNA synthetases class I (W an 2e-51
cd00395273 cd00395, Tyr_Trp_RS_core, catalytic core domain of tyro 3e-24
cd00805269 cd00805, TyrRS_core, catalytic core domain of tyrosinyl 6e-07
TIGR00234377 TIGR00234, tyrS, tyrosyl-tRNA synthetase 0.002
PRK12283398 PRK12283, PRK12283, tryptophanyl-tRNA synthetase; Revie 2e-38
PRK12285368 PRK12285, PRK12285, tryptophanyl-tRNA synthetase; Revie 1e-17
PRK08560329 PRK08560, PRK08560, tyrosyl-tRNA synthetase; Validated 5e-07
PTZ00348 682 PTZ00348, PTZ00348, tyrosyl-tRNA synthetase; Provisiona 1e-06
KOG2144360 KOG2144, KOG2144, KOG2144, Tyrosyl-tRNA synthetase, cyt 2e-05
PRK12283398 PRK12283, PRK12283, tryptophanyl-tRNA synthetase; Revie 1e-07
PTZ00126383 PTZ00126, PTZ00126, tyrosyl-tRNA synthetase; Provisiona 0.003
>gnl|CDD|179170 PRK00927, PRK00927, tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178474 PLN02886, PLN02886, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|30529 COG0180, TrpS, Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161780 TIGR00233, trpS, tryptophanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183592 PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|183400 PRK12282, PRK12282, tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>gnl|CDD|183402 PRK12284, PRK12284, tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|37924 KOG2713, KOG2713, KOG2713, Mitochondrial tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173903 cd00806, TrpRS_core, catalytic core domain of tryptophanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|144245 pfam00579, tRNA-synt_1b, tRNA synthetases class I (W and Y) Back     alignment and domain information
>gnl|CDD|173893 cd00395, Tyr_Trp_RS_core, catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173902 cd00805, TyrRS_core, catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|161781 TIGR00234, tyrS, tyrosyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183401 PRK12283, PRK12283, tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183403 PRK12285, PRK12285, tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|181468 PRK08560, PRK08560, tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|173541 PTZ00348, PTZ00348, tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|37355 KOG2144, KOG2144, KOG2144, Tyrosyl-tRNA synthetase, cytoplasmic [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183401 PRK12283, PRK12283, tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|185462 PTZ00126, PTZ00126, tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 355 tryptophanyl-tRNA synthetase [Candidatus Liberibacter a
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 100.0
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 100.0
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 100.0
PRK12284 436 tryptophanyl-tRNA synthetase; Reviewed 100.0
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 100.0
TIGR00233366 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306 100.0
KOG2713347 consensus 100.0
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 100.0
PRK12285369 tryptophanyl-tRNA synthetase; Reviewed 100.0
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 100.0
PRK08560333 tyrosyl-tRNA synthetase; Validated 100.0
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 100.0
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 100.0
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 100.0
PTZ00126399 tyrosyl-tRNA synthetase; Provisional 100.0
KOG2145397 consensus 100.0
KOG2144360 consensus 99.97
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 99.94
PRK13354405 tyrosyl-tRNA synthetase; Provisional 99.92
PRK05912402 tyrosyl-tRNA synthetase; Validated 99.89
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.63
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 98.03
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 97.82
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 97.29
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 96.82
TIGR00234422 tyrS tyrosyl-tRNA synthetase; InterPro: IPR002307 The a 99.26
KOG2623467 consensus 99.19
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 98.28
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 97.1
TIGR00392 938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 95.33
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 94.93
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 93.53
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 90.52
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 98.17
PRK12410433 glutamyl-tRNA synthetase; Provisional 97.61
PRK01406 467 gltX glutamyl-tRNA synthetase; Reviewed 97.56
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 97.54
PRK12558 461 glutamyl-tRNA synthetase; Provisional 97.52
PRK00574 489 gltX glutamyl-tRNA synthetase; Reviewed 97.44
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 97.31
PRK12267 644 methionyl-tRNA synthetase; Reviewed 97.18
COG0008 472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 97.09
PRK04156 566 gltX glutamyl-tRNA synthetase; Provisional 96.99
PRK12268 558 methionyl-tRNA synthetase; Reviewed 96.9
COG0143 558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 96.85
TIGR00464 513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 96.79
cd00814319 MetRS_core This is the catalytic core domain of methion 96.5
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 96.5
PRK11893 512 methionyl-tRNA synthetase; Reviewed 96.42
TIGR00398 573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 96.42
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 96.38
PRK00133 666 metG methionyl-tRNA synthetase; Reviewed 96.0
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 95.66
cd00672213 CysRS_core This is the catalytic core domain of cystein 95.38
PRK05347 556 glutaminyl-tRNA synthetase; Provisional 95.21
KOG1149 524 consensus 94.02
TIGR00463 600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 93.7
KOG1147 712 consensus 93.55
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 97.21
cd00674354 LysRS_core_class_I This is the catalytic core domain of 96.17
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 96.0
COG1384 521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 95.36
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 94.02
cd00817363 ValRS_core This is the catalytic core domain of valine 93.96
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 91.18
PRK12451562 arginyl-tRNA synthetase; Reviewed 90.62
TIGR00467 539 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 Th 90.15
TIGR00456 600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 90.02
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 95.44
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 94.04
PRK12300 888 leuS leucyl-tRNA synthetase; Reviewed 91.84
PRK13804 966 ileS isoleucyl-tRNA synthetase; Provisional 90.5
PRK12268558 methionyl-tRNA synthetase; Reviewed 93.17
PRK12267 644 methionyl-tRNA synthetase; Reviewed 91.71
KOG0433 937 consensus 90.14
TIGR00422 970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 92.22
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2713 consensus Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00806 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain Back     alignment and domain information
>pfam00579 tRNA-synt_1b tRNA synthetases class I (W and Y) Back     alignment and domain information
>cd00805 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic core domain Back     alignment and domain information
>PTZ00126 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2145 consensus Back     alignment and domain information
>KOG2144 consensus Back     alignment and domain information
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain Back     alignment and domain information
>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain Back     alignment and domain information
>cd00808 GluRS_core Descriminating Glutamyl-tRNA synthetase (GluRS) catalytic core domain Back     alignment and domain information
>cd00807 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) and non-descriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain Back     alignment and domain information
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain Back     alignment and domain information
>TIGR00234 tyrS tyrosyl-tRNA synthetase; InterPro: IPR002307 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2623 consensus Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00750 tRNA-synt_1d tRNA synthetases class I (R) Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>PRK12410 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00574 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>cd00672 CysRS_core This is the catalytic core domain of cysteinyl tRNA synthetase (CysRS) Back     alignment and domain information
>PRK05347 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1149 consensus Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1147 consensus Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS) Back     alignment and domain information
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K) Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target355 tryptophanyl-tRNA synthetase [Candidatus Liberibacter a
3n9i_A346 Crystal Structure Of Tryptophanyl-Trna Synthetase F 2e-92
1i6m_A328 1.7 High Resolution Experimental Phases For Tryptop 3e-87
2el7_A337 Crystal Structure Of Tryptophanyl-Trna Synthetase F 1e-86
1d2r_A326 2.9 A Crystal Structure Of Ligand-Free Tryptophanyl 3e-86
3prh_A388 Tryptophanyl-Trna Synthetase Val144pro Mutant From 7e-86
2g36_A340 Crystal Structure Of Tryptophanyl-Trna Synthetase ( 3e-84
3fi0_A326 Crystal Structure Analysis Of B. Stearothermophilus 6e-84
1i6k_A328 1.7 High Resolution Experimental Phases For Tryptop 6e-84
3fhj_F297 Independent Saturation Of Three Trprs Subsites Gene 3e-77
3fhj_A300 Independent Saturation Of Three Trprs Subsites Gene 3e-77
3fhj_E293 Independent Saturation Of Three Trprs Subsites Gene 3e-76
3m5w_A322 Crystal Structure Of Tryptophanyl-Trna Synthetase F 7e-74
3fhj_B292 Independent Saturation Of Three Trprs Subsites Gene 5e-73
3fhj_D287 Independent Saturation Of Three Trprs Subsites Gene 5e-73
3fhj_C280 Independent Saturation Of Three Trprs Subsites Gene 1e-69
2a4m_A331 Structure Of Trprs Ii Bound To Atp Length = 331 8e-68
1yi8_B351 Crystal Structure Of Tryptophanyl Trrna Synthetase 2e-66
2yy5_A348 Crystal Structure Of Tryptophanyl-Trna Synthetase F 2e-53
3kt0_A438 Crystal Structure Of S. Cerevisiae Tryptophanyl-Trn 2e-14
2ip1_A432 Crystal Structure Analysis Of S. Cerevisiae Tryptop 2e-14
2quh_A477 Crystal Structures Of Human Tryptophanyl-Trna Synth 2e-14
2cyc_A375 Crystal Structure Of Tyrosyl-Trna Synthetase Comple 5e-14
1ulh_A390 A Short Peptide Insertion Crucial For Angiostatic A 5e-14
2quj_B384 Crystal Structures Of Human Tryptophanyl-Trna Synth 7e-14
2ake_A384 Structure Of Human Tryptophanyl-Trna Synthetase In 8e-14
1o5t_A378 Crystal Structure Of The Aminoacylation Catalytic F 8e-14
3p0j_A 690 Leishmania Major Tyrosyl-Trna Synthetase In Complex 3e-13
1r6u_A437 Crystal Structure Of An Active Fragment Of Human Tr 4e-11
1r6t_A477 Crystal Structure Of Human Tryptophanyl-Trna Synthe 4e-11
2azx_A477 Charged And Uncharged Trnas Adopt Distinct Conforma 4e-11
3p0h_A 690 Leishmania Major Tyrosyl-Trna Synthetase In Complex 3e-09
2dlc_X394 Crystal Structure Of The Ternary Complex Of Yeast T 1e-08
3hv0_A393 Tryptophanyl-Trna Synthetase From Cryptosporidium P 2e-07
3i05_A395 Tryptophanyl-Trna Synthetase From Trypanosoma Bruce 4e-07
3a04_A372 Crystal Structure Of Tryptophanyl-Trna Synthetase F 9e-22
3jxe_A392 Crystal Structure Of Pyrococcus Horikoshii Tryptoph 6e-18
1j1u_A306 Crystal Structure Of Archaeal Tyrosyl-Trna Syntheta 3e-16
1zh0_A314 Crystal Structure Of L-3-(2-Napthyl)alanine-Trna Sy 1e-15
2ag6_A314 Crystal Structure Of P-Bromo-L-Phenylalanine-Trna S 2e-15
3qe4_A312 An Evolved Aminoacyl-Trna Synthetase With Atypical 2e-15
2hgz_A306 Crystal Structure Of A P-Benzoyl-L-Phenylalanyl-Trn 2e-15
1u7x_A312 Crystal Structure Of A Mutant M. Jannashii Tyrosyl- 3e-15
3n2y_A314 Crystal Structure Of Tyrosyl-Trna Synthetase Comple 8e-15
1zh6_A314 Crystal Structure Of P-Acetylphenylalanine-Trna Syn 9e-15
3d6u_A314 Crystal Structure Of 4-(Trifluoromethyldiazirinyl) 6e-14
2j5b_A348 Structure Of The Tyrosyl Trna Synthetase From Acant 2e-13
2zp1_A314 Structual Basis Of Iodo-Tyrosine Recognition By Eng 7e-13
2pxh_A314 Crystal Structure Of A Bipyridylalanyl-Trna Synthet 1e-11
2cyb_A323 Crystal Structure Of Tyrosyl-Trna Synthetase Comple 2e-10
3foc_A451 Tryptophanyl-Trna Synthetase From Giardia Lamblia L 1e-09
2cya_A364 Crystal Structure Of Tyrosyl-Trna Synthetase From A 2e-07
1h3f_A432 Tyrosyl-Trna Synthetase From Thermus Thermophilus C 3e-06
gi|301016057|pdb|3N9I|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Yersinia Pestis Co92 Length = 346 Back     alignment and structure
 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 136/352 (38%), Positives = 200/352 (56%), Gaps = 21/352 (5%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           +SS  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT       LR
Sbjct: 12  VSSKPIVFSGAQPSGELTIGNYMGALRQWVQMQD--DYDCIYCIVDLHAITARQDPALLR 69

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            ++   +A +LA G+DP ++ IF QS V  H+ LSW L+C    G ++ M QFK+KS   
Sbjct: 70  KRTLDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFGELSRMTQFKDKSARY 129

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
             E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA RFN  +        
Sbjct: 130 A-ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIASRFNNLYG------- 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                        F I E  I  + +R+ SL+D +KKMSKSD +  + I LL++P  + K
Sbjct: 182 -----------DIFKIPEPFIPKAGARVMSLQDPTKKMSKSDDNRNNVIELLEDPKSVVK 230

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI++A TD D        +E +    NL++I + +    I E   QF G+ +   K A+A
Sbjct: 231 KIKRAMTDSDEPALIRYDVEKKAGVSNLLDILSGVTGQSIPELEAQFTGQMYGHLKGAVA 290

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           DAV   +  + ++ +   +D++ L  ++ EGA +AR RAQ T+  V E +G 
Sbjct: 291 DAVSGMLSELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAIGF 342


>gi|16974813|pdb|1I6M|A Chain A, 1.7 High Resolution Experimental Phases For Tryptophanyl- Trna Synthetase Complexed With Tryptophanyl-5'amp Length = 328 Back     alignment and structure
gi|170292175|pdb|2EL7|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Thermus Thermophilus Length = 337 Back     alignment and structure
>gi|7546192|pdb|1D2R|A Chain A, 2.9 A Crystal Structure Of Ligand-Free Tryptophanyl-Trna Synthetase: Domain Movements Fragment The Adenine Nucleotide Binding Site. Length = 326 Back     alignment and structure
>gi|319443750|pdb|3PRH|A Chain A, Tryptophanyl-Trna Synthetase Val144pro Mutant From B. Subtilis Length = 388 Back     alignment and structure
>gi|93279847|pdb|2G36|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase (Ec 6.1.1.2) (Tryptophan-Trna Ligase)(Trprs) (Tm0492) From Thermotoga Maritima At 2.50 A Resolution Length = 340 Back     alignment and structure
>gi|253722679|pdb|3FI0|A Chain A, Crystal Structure Analysis Of B. Stearothermophilus Tryptophanyl-Trna Synthetase Complexed With Tryptophan, Amp, And Inorganic Phosphate Length = 326 Back     alignment and structure
>gi|16974811|pdb|1I6K|A Chain A, 1.7 High Resolution Experimental Phases For Tryptophanyl- Trna Synthetase Complexed With Tryptophanyl-5'amp Length = 328 Back     alignment and structure
>gi|292659842|pdb|3M5W|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Campylobacter Jejuni Length = 322 Back     alignment and structure
>gi|73536116|pdb|2A4M|A Chain A, Structure Of Trprs Ii Bound To Atp Length = 331 Back     alignment and structure
gi|61680678|pdb|1YI8|B Chain B, Crystal Structure Of Tryptophanyl Trrna Synthetase Ii From Deinococcus Radiodurans In Complex With L-Trp Length = 351 Back     alignment and structure
>gi|186972918|pdb|2YY5|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Mycoplasma Pneumoniae Length = 348 Back     alignment and structure
>gi|288965772|pdb|3KT0|A Chain A, Crystal Structure Of S. Cerevisiae Tryptophanyl-Trna Synthet Length = 438 Back     alignment and structure
gi|151567662|pdb|2IP1|A Chain A, Crystal Structure Analysis Of S. Cerevisiae Tryptophanyl Trna Synthetase Length = 432 Back     alignment and structure
>gi|186972755|pdb|2QUH|A Chain A, Crystal Structures Of Human Tryptophanyl-Trna Synthetase In Complex With Trp Length = 477 Back     alignment and structure
gi|83754906|pdb|2CYC|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase Complexed With L-Tyrosine From Pyrococcus Horikoshii Length = 375 Back     alignment and structure
>gi|42543730|pdb|1ULH|A Chain A, A Short Peptide Insertion Crucial For Angiostatic Activity Of Human Tryptophanyl-Trna Synthetase Length = 390 Back     alignment and structure
>gi|112489952|pdb|2AKE|A Chain A, Structure Of Human Tryptophanyl-Trna Synthetase In Complex With Trna(Trp) Length = 384 Back     alignment and structure
>gi|50513261|pdb|1O5T|A Chain A, Crystal Structure Of The Aminoacylation Catalytic Fragment Of Human Tryptophanyl-Trna Synthetase Length = 378 Back     alignment and structure
>gi|326634434|pdb|3P0J|A Chain A, Leishmania Major Tyrosyl-Trna Synthetase In Complex With Tyrosinol, Triclinic Crystal Form 1 Length = 690 Back     alignment and structure
>gi|40889612|pdb|1R6U|A Chain A, Crystal Structure Of An Active Fragment Of Human Tryptophanyl-Trna Synthetase With Cytokine Activity Length = 437 Back     alignment and structure
>gi|40889610|pdb|1R6T|A Chain A, Crystal Structure Of Human Tryptophanyl-Trna Synthetase Length = 477 Back     alignment and structure
>gi|112490030|pdb|2AZX|A Chain A, Charged And Uncharged Trnas Adopt Distinct Conformations When Complexed With Human Tryptophanyl-Trna Synthetase Length = 477 Back     alignment and structure
>gi|326634430|pdb|3P0H|A Chain A, Leishmania Major Tyrosyl-Trna Synthetase In Complex With Fisetin, Cubic Crystal Form Length = 690 Back     alignment and structure
gi|149241068|pdb|2DLC|X Chain X, Crystal Structure Of The Ternary Complex Of Yeast Tyrosyl- Trna Synthetase Length = 394 Back     alignment and structure
>gi|242556766|pdb|3HV0|A Chain A, Tryptophanyl-Trna Synthetase From Cryptosporidium Parvum Length = 393 Back     alignment and structure
>gi|254839593|pdb|3I05|A Chain A, Tryptophanyl-Trna Synthetase From Trypanosoma Brucei Length = 395 Back     alignment and structure
gi|290789897|pdb|3A04|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Hyperthermophilic Archaeon, Aeropyrum Pernix K1 Length = 372 Back     alignment and structure
>gi|266618748|pdb|3JXE|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Tryptophanyl-Trna Synthetase In Complex With Trpamp Length = 392 Back     alignment and structure
gi|31615439|pdb|1J1U|A Chain A, Crystal Structure Of Archaeal Tyrosyl-Trna Synthetase Complexed With Trna(Tyr) And L-Tyrosine Length = 306 Back     alignment and structure
>gi|93278581|pdb|1ZH0|A Chain A, Crystal Structure Of L-3-(2-Napthyl)alanine-Trna Synthetasein Complex With L-3-(2-Napthyl)alanine Length = 314 Back     alignment and structure
>gi|93278672|pdb|2AG6|A Chain A, Crystal Structure Of P-Bromo-L-Phenylalanine-Trna Sythetase In Complex With P-Bromo-L-Phenylalanine Length = 314 Back     alignment and structure
>gi|323463147|pdb|3QE4|A Chain A, An Evolved Aminoacyl-Trna Synthetase With Atypical Polysubstrate Specificity Length = 312 Back     alignment and structure
>gi|149241961|pdb|2HGZ|A Chain A, Crystal Structure Of A P-Benzoyl-L-Phenylalanyl-Trna Synthetase Length = 306 Back     alignment and structure
>gi|67463836|pdb|1U7X|A Chain A, Crystal Structure Of A Mutant M. Jannashii Tyrosyl-Trna Synthetase Specific For O-Methyl-Tyrosine Length = 312 Back     alignment and structure
>gi|310942792|pdb|3N2Y|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase Complexed With P-(2- Tetrazolyl)-Phenylalanine Length = 314 Back     alignment and structure
>gi|93278582|pdb|1ZH6|A Chain A, Crystal Structure Of P-Acetylphenylalanine-Trna Synthetase In Complex With P-Acetylphenylalanine Length = 314 Back     alignment and structure
>gi|189096270|pdb|3D6U|A Chain A, Crystal Structure Of 4-(Trifluoromethyldiazirinyl) Phenylalanyl-Trna Synthetase Length = 314 Back     alignment and structure
>gi|158428905|pdb|2J5B|A Chain A, Structure Of The Tyrosyl Trna Synthetase From Acanthamoeba Polyphaga Mimivirus Complexed With Tyrosynol Length = 348 Back     alignment and structure
>gi|223673858|pdb|2ZP1|A Chain A, Structual Basis Of Iodo-Tyrosine Recognition By Engineered Archeal Tyrosyl-Trna Synthetase Length = 314 Back     alignment and structure
>gi|167013270|pdb|2PXH|A Chain A, Crystal Structure Of A Bipyridylalanyl-Trna Synthetase Length = 314 Back     alignment and structure
gi|83754904|pdb|2CYB|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase Complexed With L-Tyrosine From Archaeoglobus Fulgidus Length = 323 Back     alignment and structure
>gi|220702585|pdb|3FOC|A Chain A, Tryptophanyl-Trna Synthetase From Giardia Lamblia Length = 451 Back     alignment and structure
gi|83754903|pdb|2CYA|A Chain A, Crystal Structure Of Tyrosyl-Trna Synthetase From Aeropyrum Pernix Length = 364 Back     alignment and structure
gi|24158659|pdb|1H3F|A Chain A, Tyrosyl-Trna Synthetase From Thermus Thermophilus Complexed With Tyrosinol Length = 432 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 tryptophanyl-tRNA synthetase [Candidatus Liberibacter a
3n9i_A346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, c 2e-85
3m5w_A322 Tryptophanyl-tRNA synthetase; alpha-beta structure, csg 6e-75
1i6k_A328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synth 4e-65
2yy5_A348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetas 2e-57
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase 2e-52
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A { 5e-52
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural genomi 2e-51
2cyc_A375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylatio 3e-49
1n3l_A372 Tyrosyl-tRNA synthetase; rossmann fold AS catalytic dom 5e-48
3hv0_A393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, 2e-45
1r6u_A437 Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, 3e-43
1r6t_A477 Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, 3e-43
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structur 2e-41
2ip1_A432 Tryptophanyl-tRNA synthetase; rossmann fold, structural 1e-38
2dlc_X394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase/tRN 2e-38
3i05_A395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-bind 3e-37
2cya_A364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structu 1e-36
3jxe_A392 Tryptophanyl-tRNA synthetase; adenosine triphosphate, r 2e-33
2j5b_A348 Tyrosyl-tRNA synthetase; tyrosynol, ligase; HET: TYB; 2 6e-32
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthet 1e-14
3foc_A451 Tryptophanyl-tRNA synthetase; structural genomics, giar 9e-42
2zp1_A314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, liga 2e-41
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural geno 3e-19
>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} Length = 346 Back     alignment and structure
 Score =  310 bits (796), Expect = 2e-85
 Identities = 134/345 (38%), Positives = 195/345 (56%), Gaps = 21/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
            SG QP+G L +GNY+G +R  ++ Q+  +   +Y I DLHAIT       LR ++   +
Sbjct: 19  FSGAQPSGELTIGNYMGALRQWVQMQDDYD--CIYCIVDLHAITARQDPALLRKRTLDTL 76

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP ++ IF QS V  H+ LSW L+C    G ++ M QFK+KS    E   + 
Sbjct: 77  ALYLACGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFGELSRMTQFKDKSARYAEN-INA 135

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA RFN  +               
Sbjct: 136 GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIASRFNNLY--------------- 180

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E  I  + +R+ SL+D +KKMSKSD +  + I LL++P  + KKI++A T
Sbjct: 181 ---GDIFKIPEPFIPKAGARVMSLQDPTKKMSKSDDNRNNVIELLEDPKSVVKKIKRAMT 237

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D D        +E +    NL++I + +    I E   QF G+ +   K A+ADAV   +
Sbjct: 238 DSDEPALIRYDVEKKAGVSNLLDILSGVTGQSIPELEAQFTGQMYGHLKGAVADAVSGML 297

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             + ++ +   +D++ L  ++ EGA +AR RAQ T+  V E +G 
Sbjct: 298 SELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAIGF 342


>3m5w_A Tryptophanyl-tRNA synthetase; alpha-beta structure, csgid, aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding; 2.32A {Campylobacter jejuni} Length = 322 Back     alignment and structure
>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A Length = 328 Back     alignment and structure
>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae M129} Length = 348 Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural genomics, NPPSFA; 2.50A {Thermus thermophilus HB8} Length = 337 Back     alignment and structure
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans R1} PDB: 1yia_B* 1yid_B* 2a4m_A* Length = 351 Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: TRP; 2.50A {Thermotoga maritima} Length = 340 Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics, NPPSFA; HET: TYR; 2.20A {Pyrococcus horikoshii OT3} Length = 375 Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognition domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Length = 372 Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} Length = 393 Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, anticodon recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Length = 437 Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, anticodon recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Length = 477 Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural genomics of pathogenic protozoa, MSGPP; 3.00A {Entamoeba histolytica} Length = 386 Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} Length = 432 Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase/tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Length = 394 Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} Length = 395 Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Length = 364 Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Length = 392 Back     alignment and structure
>2j5b_A Tyrosyl-tRNA synthetase; tyrosynol, ligase; HET: TYB; 2.2A {Mimivirus} Length = 348 Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYB; 2.0A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Length = 432 Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasis, aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Length = 451 Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3d6u_A* 3d6v_A* 1u7x_A 2hgz_A* Length = 314 Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target355 tryptophanyl-tRNA synthetase [Candidatus Liberibacter a
3n9i_A346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, c 100.0
1i6k_A328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synth 100.0
3m5w_A322 Tryptophanyl-tRNA synthetase; alpha-beta structure, csg 100.0
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase 100.0
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A { 100.0
2yy5_A348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetas 100.0
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural genomi 100.0
3jxe_A392 Tryptophanyl-tRNA synthetase; adenosine triphosphate, r 100.0
3foc_A451 Tryptophanyl-tRNA synthetase; structural genomics, giar 100.0
3hv0_A393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, 100.0
2cya_A364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structu 100.0
2ip1_A432 Tryptophanyl-tRNA synthetase; rossmann fold, structural 100.0
2dlc_X394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase/tRN 100.0
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structur 100.0