254780807

254780807

glucose-inhibited division protein B

GeneID in NCBI database:8209813Locus tag:CLIBASIA_03490
Protein GI in NCBI database:254780807Protein Accession:YP_003065220.1
Gene range:+(449217, 449723)Protein Length:168aa
Gene description:glucose-inhibited division protein B
COG prediction:[M] Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division
KEGG prediction:gidB; glucose-inhibited division protein B; K03501 glucose inhibited division protein B [EC:2.1.-.-]
SEED prediction:probable glucose inhibited division protein B
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MKYCDSNSILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQKK
ccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEcccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHccccEEEEEHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccc
cccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEccccccccEEEEEccccccccccHHEEcccccccEEEEEccHHHHHHHHHHHHHHHcccccEHHHHHHHHccccccccHHHHHHHHcHHHHHHHHHHHHHccc
mkycdsnsilRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRvfqlhpypsiwidlgsgggfpgiITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRiqeapqmittCDVISARALADLDTLleysfpwlyqkk
mkycdsnsilraNYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLleysfpwlyqkk
MKYCDSNSILRANYLLNTYNVSRETlekleyfyflflkWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQKK
**********RANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQ**
MKYCDSNSILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQKK
MKYCDSNSILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQ**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYCDSNSILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQKK
MKYCDSNSILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQKK
MKYCDSNSILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWLYQKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target168 glucose-inhibited division protein B [Candidatus Liberi
315122030176 16S rRNA methyltransferase GidB [Candidatus Liberibacte 1 1e-51
150398395213 16S rRNA methyltransferase GidB [Sinorhizobium medicae 1 6e-50
15967089213 glucose-inhibited division protein B [Sinorhizobium mel 1 2e-48
222087927205 glucose inhibited division protein B [Agrobacterium rad 1 6e-48
227823854214 16S rRNA methyltransferase GidB [Sinorhizobium fredii N 1 6e-47
209551500205 16S rRNA methyltransferase GidB [Rhizobium leguminosaru 1 8e-47
116254461205 16S rRNA methyltransferase GidB [Rhizobium leguminosaru 1 3e-45
86359699205 glucose-inhibited division protein B [Rhizobium etli CF 1 7e-45
218682745205 glucose-inhibited division protein B [Rhizobium etli CI 1 9e-45
15890075205 glucose-inhibited division protein B [Agrobacterium tum 1 2e-44
>gi|315122030|ref|YP_004062519.1| 16S rRNA methyltransferase GidB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 176 Back     alignment and organism information
 Score =  205 bits (522), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 92/120 (76%), Positives = 107/120 (89%)

Query: 45  LVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLI 104
           +VS STVEDFW RH+EDSLRVFQLHPY S+W+DLGSGGGFPGI+TSIQL+ I+GG VNLI
Sbjct: 1   MVSPSTVEDFWKRHIEDSLRVFQLHPYSSVWVDLGSGGGFPGIVTSIQLAEIKGGWVNLI 60

Query: 105 ESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMITTCDVISARALADLDTLLEYSFPWL 164
           ES NKKA FLRYV+++T ARGKVF+CRIQEA ++I  CD+ISARALA+LD LLEYSFPW 
Sbjct: 61  ESNNKKAGFLRYVLKQTEARGKVFSCRIQEASKLIEKCDIISARALANLDILLEYSFPWF 120


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150398395|ref|YP_001328862.1| 16S rRNA methyltransferase GidB [Sinorhizobium medicae WSM419] Length = 213 Back     alignment and organism information
>gi|15967089|ref|NP_387442.1| glucose-inhibited division protein B [Sinorhizobium meliloti 1021] Length = 213 Back     alignment and organism information
>gi|222087927|ref|YP_002546465.1| glucose inhibited division protein B [Agrobacterium radiobacter K84] Length = 205 Back     alignment and organism information
>gi|227823854|ref|YP_002827827.1| 16S rRNA methyltransferase GidB [Sinorhizobium fredii NGR234] Length = 214 Back     alignment and organism information
>gi|209551500|ref|YP_002283417.1| 16S rRNA methyltransferase GidB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 205 Back     alignment and organism information
>gi|116254461|ref|YP_770299.1| 16S rRNA methyltransferase GidB [Rhizobium leguminosarum bv. viciae 3841] Length = 205 Back     alignment and organism information
>gi|86359699|ref|YP_471591.1| glucose-inhibited division protein B [Rhizobium etli CFN 42] Length = 205 Back     alignment and organism information
>gi|218682745|ref|ZP_03530346.1| glucose-inhibited division protein B [Rhizobium etli CIAT 894] Length = 205 Back     alignment and organism information
>gi|15890075|ref|NP_355756.1| glucose-inhibited division protein B [Agrobacterium tumefaciens str. C58] Length = 205 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target168 glucose-inhibited division protein B [Candidatus Liberi
PRK00107187 PRK00107, gidB, 16S rRNA methyltransferase GidB; Review 4e-38
pfam02527184 pfam02527, GidB, rRNA small subunit methyltransferase G 5e-26
TIGR00138181 TIGR00138, gidB, 16S rRNA methyltransferase GidB 1e-24
COG0357215 COG0357, GidB, Predicted S-adenosylmethionine-dependent 2e-32
>gnl|CDD|178868 PRK00107, gidB, 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>gnl|CDD|111429 pfam02527, GidB, rRNA small subunit methyltransferase G Back     alignment and domain information
>gnl|CDD|129244 TIGR00138, gidB, 16S rRNA methyltransferase GidB Back     alignment and domain information
>gnl|CDD|30706 COG0357, GidB, Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 168 glucose-inhibited division protein B [Candidatus Liberi
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 100.0
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 100.0
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 100.0
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 100.0
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 98.76
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 98.41
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 98.35
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.31
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 98.3
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.28
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 98.18
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 98.07
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 98.04
PRK12335289 tellurite resistance protein TehB; Provisional 97.77
pfam08003 315 Methyltransf_9 Protein of unknown function (DUF1698). T 97.23
KOG1271227 consensus 96.03
KOG1540296 consensus 92.25
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 91.04
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 98.63
PRK07402196 precorrin-6B methylase; Provisional 98.46
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 98.43
COG4123248 Predicted O-methyltransferase [General function predict 98.39
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 98.39
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.37
PRK11036 256 putative metallothionein SmtA; Provisional 98.36
pfam05175170 MTS Methyltransferase small domain. This domain is foun 98.36
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 98.33
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 98.32
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 98.31
PRK08317 241 hypothetical protein; Provisional 98.26
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 98.23
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 98.23
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 98.17
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 98.15
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.12
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 98.05
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 97.91
KOG1499 346 consensus 97.9
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 97.81
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 97.8
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 97.78
COG4122219 Predicted O-methyltransferase [General function predict 97.71
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 97.67
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 97.63
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 97.58
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 97.49
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 97.47
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 97.47
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 97.46
KOG2904328 consensus 97.44
pfam02353 273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 97.43
PRK11207198 tellurite resistance protein TehB; Provisional 97.42
PRK13943 317 protein-L-isoaspartate O-methyltransferase; Provisional 97.41
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 97.38
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 97.34
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 97.32
PRK01683 252 trans-aconitate 2-methyltransferase; Provisional 97.3
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provisional 97.29
KOG1270282 consensus 97.24
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.22
pfam10294171 Methyltransf_16 Putative methyltransferase. 97.19
COG2230 283 Cfa Cyclopropane fatty acid synthase and related methyl 97.03
PRK05785225 hypothetical protein; Provisional 96.9
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 96.83
PRK10258 251 biotin biosynthesis protein BioC; Provisional 96.8
PRK06202233 hypothetical protein; Provisional 96.69
KOG1500 517 consensus 96.54
TIGR02072 272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 96.48
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 96.09
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 96.06
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 95.96
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 95.88
COG4076 252 Predicted RNA methylase [General function prediction on 95.85
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Provisio 95.85
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 95.76
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 95.71
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 95.68
pfam09243 275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 95.61
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 95.58
COG2520341 Predicted methyltransferase [General function predictio 95.56
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 95.54
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 95.4
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 95.32
PRK10901428 16S rRNA methyltransferase B; Provisional 95.17
KOG1501 636 consensus 94.79
COG3897218 Predicted methyltransferase [General function predictio 93.84
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 93.71
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 93.38
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 93.18
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 92.33
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 92.07
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 91.98
pfam08704 309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 91.77
PTZ00338 296 dimethyladenosine transferase; Provisional 91.77
pfam05219265 DREV DREV methyltransferase. This family contains DREV 91.16
pfam01861 243 DUF43 Protein of unknown function DUF43. This family in 90.95
KOG3010 261 consensus 90.89
PRK06922 679 hypothetical protein; Provisional 90.88
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 90.72
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 98.29
pfam03848192 TehB Tellurite resistance protein TehB. 97.8
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 96.52
KOG4300252 consensus 96.48
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 94.56
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 95.59
KOG2793248 consensus 94.74
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 94.3
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 93.54
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 92.36
pfam00398 258 RrnaAD Ribosomal RNA adenine dimethylase. 91.53
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 91.0
smart00650169 rADc Ribosomal RNA adenine dimethylases. 90.3
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>pfam09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1501 consensus Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>KOG2793 consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target168 glucose-inhibited division protein B [Candidatus Liberi
1xdz_A240 Crystal Structure Of Gram_positive Bacillus Subtili 1e-27
1jsx_A207 Crystal Structure Of The Escherichia Coli Glucose-I 1e-22
3g88_A249 T. Thermophilus 16s Rrna G527 Methyltransferase In 4e-04
>gi|56554498|pdb|1XDZ|A Chain A, Crystal Structure Of Gram_positive Bacillus Subtilis Glucose Inhibited Division Protein B (Gidb), Structural Genomics, Mcsg Length = 240 Back     alignment and structure
 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 10/168 (5%)

Query: 6   SN-SILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVED--S 62
            N     +       ++S   LE+ E +Y + ++W++KINL S +  ++ +++H  D  +
Sbjct: 2   MNIEEFTSGLAEKGISLSPRQLEQFELYYDMLVEWNEKINLTSITEKKEVYLKHFYDSIT 61

Query: 63  LRVFQLHPYPSIWIDLGSGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTA 122
              +      +   D+G+G GFP +   I    +    V +++S NK+ +FL  + +   
Sbjct: 62  AAFYVDFNQVNTICDVGAGAGFPSLPIKICFPHL---HVTIVDSLNKRITFLEKLSEALQ 118

Query: 123 ARGKVFACRIQE----APQMITTCDVISARALADLDTLLEYSFPWLYQ 166
                F     E       +  + D+++ARA+A L  L E   P + +
Sbjct: 119 LENTTFCHDRAETFGQRKDVRESYDIVTARAVARLSVLSELCLPLVKK 166


gi|21465733|pdb|1JSX|A Chain A, Crystal Structure Of The Escherichia Coli Glucose-Inhibited Division Protein B (Gidb) Length = 207 Back     alignment and structure
>gi|242556525|pdb|3G88|A Chain A, T. Thermophilus 16s Rrna G527 Methyltransferase In Complex With Adomet In Space Group P61 Length = 249 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target168 glucose-inhibited division protein B [Candidatus Liberi
1jsx_A207 Glucose-inhibited division protein B; methyltransferase 1e-25
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 16S rR 6e-25
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure initiat 9e-21
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Length = 207 Back     alignment and structure
 Score =  111 bits (278), Expect = 1e-25
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 4/145 (2%)

Query: 20  NVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHPYPSIWIDLG 79
           +++     +L  +  +  KW+K  NL S     +  +RH+ DS+ V   +     +ID+G
Sbjct: 15  SLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEMLVRHILDSIVVAP-YLQGERFIDVG 73

Query: 80  SGGGFPGIITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARGKVFACRIQEAPQMI 139
           +G G PGI  SI           L++S  K+  FLR V  +             E     
Sbjct: 74  TGPGLPGIPLSIVRPEAH---FTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPSE 130

Query: 140 TTCDVISARALADLDTLLEYSFPWL 164
              D + +RA A L+ ++ +     
Sbjct: 131 PPFDGVISRAFASLNDMVSWCHHLP 155


>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Length = 249 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Length = 240 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target168 glucose-inhibited division protein B [Candidatus Liberi
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure initiat 100.0
1jsx_A207 Glucose-inhibited division protein B; methyltransferase 100.0
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 16S rR 100.0
2b3t_A276 Protein methyltransferase HEMK; translation termination 98.38
1nv8_A284 HEMK protein; class I adoMet-dependent methyltransferas 98.37
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; struc 98.16
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 97.31
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein structure i 98.65
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxylating); 98.61
2o57_A 297 Putative sarcosine dimethylglycine methyltransferase; s 98.6
2gpy_A233 O-methyltransferase; structural genomics, PSI, protein 98.58
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research cente 98.53
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; NP_34 98.52
3gu3_A 284 Methyltransferase; alpha-beta protein, structural genom 98.49
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltransfer 98.47
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine modifi 98.43
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwi 98.39
1xxl_A 239 YCGJ protein; structural genomics, protein structure in 98.38
1or8_A 340 Protein arginine N-methyltransferase 1; protein arginin 98.38
3b3f_A 341 Histone-arginine methyltransferase CARM1; protein argin 98.36
3lpm_A 259 Putative methyltransferase; structural genomics, protei 98.34
1ve3_A227 Hypothetical protein PH0226; dimer, riken structural ge 98.33
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methyltransf 98.33
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 98.32
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 98.32
1vl5_A 260 Unknown conserved protein BH2331; 10174951, hypothetica 98.31
3c3p_A210 Methyltransferase; NP_951602.1, structural genomics, jo 98.3
2fyt_A 340 Protein arginine N-methyltransferase 3; structural geno 98.27
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxylase; 98.26
2h00_A254 Methyltransferase 10 domain containing protein; structu 98.25
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; structu 98.24
3fpf_A298 Mtnas, putative uncharacterized protein; thermonicotian 98.24
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; gene d 98.23
2ozv_A260 Hypothetical protein ATU0636; structural genomics, pred 98.22
2qm3_A 373 Predicted methyltransferase; putative methyltransferase 98.21
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structural ge 98.21
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 98.19
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoaspartyl 98.19
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann-like 98.19
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; HET: S 98.18
3m70_A286 Tellurite resistance protein TEHB homolog; structural g 98.18
3f4k_A 257 Putative methyltransferase; structural genomics, PSI-2, 98.17
2yxd_A183 Probable cobalt-precorrin-6Y C(15)- methyltransferase [ 98.16
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding domain, 98.15
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, 98.15
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein argin 98.15
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgrc, pr 98.11
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase; tra 98.1
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase; met 98.1
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, protei 98.07
2i6g_A199 Putative methyltransferase; 16420133, structural genomi 98.07
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; ross 98.06
2esr_A177 Methyltransferase; structural genomics, hypothetical pr 98.06
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, transfe 98.05
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransferase, S 97.99
3g5l_A 253 Putative S-adenosylmethionine dependent methyltransfera 97.99
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; antibiot 97.98
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, struct 97.97
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, protein 97.96
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dimethyl 97.96
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossman-typ 97.96
2avd_A229 Catechol-O-methyltransferase; structural genomics, stru 97.94
3dtn_A234 Putative methyltransferase MM_2633; structural genomics 97.93
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabolism; 97.92
2frn_A278 Hypothetical protein PH0793; structural genomics, PSI, 97.91
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, structura 97.91
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural genomic 97.9
1wzn_A 252 SAM-dependent methyltransferase; structural genomics, r 97.89
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe relat 97.89
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus 97.86
2hnk_A239 SAM-dependent O-methyltransferase; modified rossman fol 97.83
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycloprop 97.82
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PSI, pr 97.81
1ws6_A171 Methyltransferase; structural genomics, riken structura 97.8
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridium the 97.79
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, 97.78
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent meth 97.77
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena vari 97.77
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent methylt 97.76
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, structu 97.76
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltransfe 97.75
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta- aspart 97.74
2kw5_A202 SLR1183 protein; structural genomics, northeast structu 97.73
2pxx_A215 Uncharacterized protein MGC2408; structural genomics co 97.72
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus thermoph 97.71
2gs9_A211 Hypothetical protein TT1324; methyl transferase, struct 97.69
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethionine-d 97.69
1yb2_A275 Hypothetical protein TA0852; structural genomics, methy 97.68
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha/beta 97.67
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structural g 97.66
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adenosyl-m 97.66
3duw_A223 OMT, O-methyltransferase, putative; alternating of alph 97.6
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, crystal, s 97.6
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 97.59
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-adenosyl 97.55
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alph 97.54
1vlm_A219 SAM-dependent methyltransferase; possible histamine N-m 97.54
1zx0_A236 Guanidinoacetate N-methyltransferase; structural genomi 97.54
3ege_A 261 Putative methyltransferase from antibiotic biosynthesis 97.54
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; protei 97.54
3ocj_A305 Putative exported protein; structural genomics, PSI-2, 97.54
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransferase, 97.51
3frh_A253 16S rRNA methylase; methyltransferase domain, helical N 97.51
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeMet, b 97.45
2p7i_A 250 Hypothetical protein; putative methyltransferase, struc 97.45
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 97.43
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal RNA pr 97.43
2aot_A 292 HMT, histamine N-methyltransferase; classic methyltrans 97.43
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- methy 97.42
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase, str 97.42
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D 97.38
3hnr_A220 Probable methyltransferase BT9727_4108; structural geno 97.38
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modified ro 97.36
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O- methyltransferas 97.35
3lcc_A235 Putative methyl chloride transferase; halide methyltran 97.35
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, structu 97.35
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_32134 97.33
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protein, st 97.32
2fpo_A202 Methylase YHHF; structural genomics, putative methyltra 97.31
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural genomics 97.29
3hvi_A221 Catechol O-methyltransferase; neurotransmitter degradat 97.27
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protein, st 97.25
1im8_A244 YECO; methyltransferase, adenosylhomocysteine, structur 97.25
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipid syn 97.24
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, tRNA m 97.24
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent meth 97.23
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messenger 97.22
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA bind 97.18
3i9f_A170 Putative type 11 methyltransferase; structural genomics 97.13
3bzb_A281 Uncharacterized protein; RED ALGA, protein structure in 97.12
1xva_A 292 Glycine N-methyltransferase; HET: SAM; 2.20A {Escherich 97.1
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glycopepti 97.06
3ou2_A218 SAM-dependent methyltransferase; O-methyltransferase, S 97.06
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, structura 97.04
1p91_A269 Ribosomal RNA large subunit methyltransferase A; RLMA, 97.02
3e8s_A227 Putative SAM dependent methyltransferase; NP_744700.1, 97.0
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmethionin 96.99
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carbohydrat 96.98
3cc8_A 230 Putative methyltransferase; NP_977653.1, structural gen 96.97
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, methyltra 96.95
2b78_A385 Hypothetical protein SMU.776; structure genomics, methy 96.69
2r3s_A335 Uncharacterized protein; methyltransferase domain, stru 96.66
1x19_A359 CRTF-related protein; methyltransferase, bacteriochlloc 96.65
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-me 96.61
2ip2_A334 Probable phenazine-specific methyltransferase; pyocyani 96.55
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwich, b 96.51
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fold; HE 96.49
3dp7_A363 SAM-dependent methyltransferase; structural genomics, p 96.48
1nw3_A 416 Histone methyltransferase DOT1L; HDOT1, histone lysine 96.48
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adeno 96.42
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, meth 96.41
2f8l_A 344 Hypothetical protein LMO1582; 16411011, structural geno 96.36
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar protein, 96.34
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann fold m 96.32
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, meth 96.18
2b25_A 336 Hypothetical protein; structural genomics, methyl trans 96.06
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 specif 96.02
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modifi 96.01
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, structura 96.01
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, SAH, S 95.95
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; methyt 95.71
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferase; tRN 95.67
3gjy_A 317 Spermidine synthase; APC62791, structural genomics, PSI 95.65
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl methioni 95.65
3ll7_A 410 Putative methyltransferase; methytransferase, structura 95.63
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, structural 95.49
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracycline 95.13
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribosomal 94.99
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-adenosy 94.77
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcytidin 94.66
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococcus h 94.61
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative spli 94.26
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; metal 94.17
1mjf_A 281 Spermidine synthase; spermidine synthetase, structural 94.17
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toronto di 93.87
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed beta she 93.83
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosylmeth 93.32
3ndi_A 416 Methyltransferase; S-adenosylmethionine, kijanose, tetr 93.22
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, rossmann 93.05
1uir_A 314 Polyamine aminopropyltransferase; spermidien synthase, 93.04
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA domain, 92.68
2yui_A182 Anamorsin; cytokine-induced apoptosis inhibitor 1, ciap 92.44
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protein; FM 92.41
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta protein, s 92.33
1fp2_A352 Isoflavone O-methytransferase; protein-product complex; 92.23
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopurine me 91.75
3adn_A 294 Spermidine synthase; aminopropyltransferase, polyamine 91.17
2pt6_A 321 Spermidine synthase; transferase, structural genomics c 90.83
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein-subst 90.69
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structural ge 90.27
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 97.98
2i62_A 265 Nicotinamide N-methyltransferase; structural genomics, 95.75
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structural ge 97.34
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, structur 95.9
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase, NPM 95.44
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F21; 2 92.07
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 91.84
1zq9_A 285 Probable dimethyladenosine transferase; SGC, structural 90.21
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
Probab=100.00  E-value=0  Score=317.09  Aligned_cols=156  Identities=24%  Similarity=0.433  Sum_probs=143.2

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHCCC--CCCCCEEECCCCCHHH
Q ss_conf             85136666417999899999999999999846321304308999998986463564310012--3443111114677335
Q gi|254780807|r    9 ILRANYLLNTYNVSRETLEKLEYFYFLFLKWSKKINLVSSSTVEDFWIRHVEDSLRVFQLHP--YPSIWIDLGSGGGFPG   86 (168)
Q Consensus         9 ~~~~~~l~~~~~ls~eq~~~l~~y~~ll~~~N~~~NLts~~~~~~~~~rHi~DSl~~~~~~~--~~~~ilDiGSGaGfPG   86 (168)
                      -+...+-..++.+|++|+++|..|+++|.+||+++||||+++.+++|.+||+||++++.+++  ...+++||||||||||
T Consensus         6 ~l~~~l~~~g~~~s~~~~~~l~~y~~lL~~~N~~~NLt~~~~~~~i~~~Hi~DSl~~~~~i~~~~~~~ilDiGSGaGfPG   85 (240)
T 1xdz_A            6 EFTSGLAEKGISLSPRQLEQFELYYDMLVEWNEKINLTSITEKKEVYLKHFYDSITAAFYVDFNQVNTICDVGAGAGFPS   85 (240)
T ss_dssp             HHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHHSCCCSCCSHHHHHHHTHHHHHGGGGTSCGGGCCEEEEECSSSCTTH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHH
T ss_conf             99999998599999999999999999999847847788639989999988997799998754356886987259998278


Q ss_pred             HHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHCCCC-EEEECHHHHHH---HCCCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             656522755466347875000038999999999738980-99804266533---12479869999147998999998488
Q gi|254780807|r   87 IITSIQLSSIEGGLVNLIESKNKKASFLRYVVQKTAARG-KVFACRIQEAP---QMITTCDVISARALADLDTLLEYSFP  162 (168)
Q Consensus        87 i~laI~~p~~~~~~v~Lves~~KK~~FL~~~~~~L~L~~-~vi~~r~e~~~---~~~~~~d~v~sRA~a~l~~ll~~~~p  162 (168)
                      |||||++|+.+   |||+||++||++||++++.+|+|+| +++++|+|+..   +++.+||+||||||++++.+++++.|
T Consensus        86 i~LaI~~p~~~---v~Lves~~KK~~FL~~v~~~L~L~nv~v~~~R~E~~~~~~~~~~~fD~v~sRAva~l~~ll~~~~~  162 (240)
T 1xdz_A           86 LPIKICFPHLH---VTIVDSLNKRITFLEKLSEALQLENTTFCHDRAETFGQRKDVRESYDIVTARAVARLSVLSELCLP  162 (240)
T ss_dssp             HHHHHHCTTCE---EEEEESCHHHHHHHHHHHHHHTCSSEEEEESCHHHHTTCTTTTTCEEEEEEECCSCHHHHHHHHGG
T ss_pred             HHHHHHCCCCC---CEEEECHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHCCCCCCCCCCCEEEEEEECCHHHHHHHHHH
T ss_conf             99998678754---188755687789999999983888737873046550322123566656986100576889999998


Q ss_pred             HHCCC
Q ss_conf             52067
Q gi|254780807|r  163 WLYQK  167 (168)
Q Consensus       163 llk~k  167 (168)
                      ++++.
T Consensus       163 ~lk~~  167 (240)
T 1xdz_A          163 LVKKN  167 (240)
T ss_dssp             GEEEE
T ss_pred             HCCCC
T ss_conf             62789



>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI, nysgxrc; 2.50A {Clostridium acetobutylicum atcc 824} SCOP: c.66.1.43 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxylating); porphyrin metabolism, S-adenosyl-methionine, structural genomics; 1.80A {Geobacter metallireducens gs-15} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; HET: MSE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research center for structural genomics, protein structure initiative, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1, methyltransferase domain, structural genomics; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.30A {Bacillus cereus atcc 14579} PDB: 2gh1_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1or8_A Protein arginine N-methyltransferase 1; protein arginine methylation, adoMet-dependent methylation, transferase; HET: SAH; 2.35A {Rattus norvegicus} SCOP: c.66.1.6 PDB: 1orh_A* 1ori_A* Back     alignment and structure
>3b3f_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase, catalytic domain, alternative splicing, chromatin regulator; HET: SAH; 2.20A {Rattus norvegicus} PDB: 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; NP_988299.1, structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; 10174951, hypothetical protein, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE; 1.95A {Bacillus halodurans c-125} SCOP: c.66.1.41 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 1f3l_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein, transferase; HET: TNA MTA; 1.66A {Methanothermobacterthermautotrophicus} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175, PSI-2; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransferase; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer, dimer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, alternative splicing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransferase posttranslational modification; 1.59A {Thermus thermophilus HB8} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2i6g_A Putative methyltransferase; 16420133, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MLY; 1.90A {Salmonella typhimurium LT2} SCOP: c.66.1.44 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes MGAS10394} SCOP: c.66.1.46 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus HB8} PDB: 2yr0_A Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative, SAM-dependent methyltransferase; HET: SAI; 1.94A {Leishmania major strain friedlin} SCOP: c.66.1.42 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, structural genomics; 2.00A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.66.1.43 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima MSB8} SCOP: c.66.1.41 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure