254780808

254780808

tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA

GeneID in NCBI database:8209814Locus tag:CLIBASIA_03495
Protein GI in NCBI database:254780808Protein Accession:YP_003065221.1
Gene range:+(447340, 449220)Protein Length:626aa
Gene description:tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
COG prediction:none
KEGG prediction:tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; K03495 glucose inhibited division protein A
SEED prediction:tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620------
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV
cccccccEEEEcccHHHHHHHHHHHHccccEEEEEEcHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHccccccEEEEEEcccccEEEcccEEEEcccccccEEEEcccccccccccccccccHHHHHHHccccHHHHHcccHHHcccccccHHHHHcccccccccEEEEEccccccccEEcccccccHHHHHHHHccHHHccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEEcccccccHHHHHHHHHHcccccccEEEcccEEEEEccccHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccHHHcccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccHHHHHHHHHHHcccccHHHHcccccccHHHHHHHHHHHHHcHHHccccccc
cEcccccEEEEcccHHHHHHHHHHHHccccEEEEcccHHHHcccccccccccccccEEEEEEcccccHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHEccccEEEEEEEccccEEEccEEEEEEccccccEEEEEccccccccccccccHHHHHHHHHccccccEcccccccccccccEccHHccccccccccccEEccccccccccccEEEEEccccHHHHHHccccccccccEEEccccccccccccccEEEEccccccEEEEccccccccEEEcccccccccHHHHHHHHHHcccccHcEEEccccEEEEEcccHHHcHHcHHHHHHcccEEcccccccccHHHHHHHccHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccEEcccHHHHHHHHcccccccccHHHHHccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccHHHHHHHHHHHcccccHcHHcccccccHHHHHHHHHHHHHccccEEEEEEc
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALIThktstigsmscnpaigglgkghLVREIDALDGLMGRVADAAGIQFRVLNvkkgpavrgprtqADRELYRLAMQREILSQENLDVIQGEvagfntekNIISSIVmqdnsmirCSTVVLTTGTFLRGVIHIgklkipagrmgdspsnslfnsfmkfdfdtgrlktgtparldgktiiwdktekqfaderlipfsfmtdkitnrqiecgitrtnlETHRIIMENIkhsaiysgdiksygprycpsieDKIVRFgernghqiflepeglntdvvypngistalpeEIQHQFIRtipglekvniirpgyaieydyinpkelfptletkKISGLFlagqingtTGYEEAAAQGLVAGINSarksnkldcicfsrtdsyigvmiddltskgvlepyrmfTSRAEYRislrpdnadnrltpigmklgCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSknlsstsisfkqdgktrtayeflsypdfsiqnlFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFeekrlipkdfdysslpalSNELKEKLsilkpfnllqaskiegmTPAALNLLLIYIKKNTVKLNEIVLV
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFrvlnvkkgpavrgprtqaDRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSivmqdnsmIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFdtgrlktgtparldgktiiwdktekqfaderlipfsfmtdkitnrqiecgitrtnlETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIflepeglntdVVYPNGISTALPEEIQHQFirtipglekvNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDdltskgvlepyRMFTSRAeyrislrpdnadnrltpigMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSknlsstsisfkqdgktRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIyikkntvklneivlv
MINRSYDVIVIggghagceaaavaaklgastaLITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV
**NRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTS****************RTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIK************
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV
MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVREIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVIQGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSNSLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIECGITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGLNTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKISGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGVLEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKSLVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIESSYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEGMTPAALNLLLIYIKKNTVKLNEIVLV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target626 tRNA uridine 5-carboxymethylaminomethyl modification en
254780842384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidat 0.009
254780675481 dihydrolipoamide dehydrogenase [Candidatus Liberib 0.010
254781055461 glutathione reductase [Candidatus Liberibacter asi 0.031
>gi|254780842|ref|YP_003065255.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Back     alignment
 Score = 33.9 bits (76), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 6  YDVIVIGGGHAGCEAAAVAAKLGASTALITHKT 38
          +DVI+IG G AG  AA  AAK G  TAL++ ++
Sbjct: 4  FDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRS 36

>gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Back     alignment
 Score = 33.5 bits (75), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 2  INRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVRE 61
          ++R YD+I+IG G AG  AA  AA+LG   A++ +  + +G +  N   G +    L+R 
Sbjct: 1  MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEY--AGLGGICLN--WGCIPTKSLLRS 56

Query: 62 IDALD 66
           + LD
Sbjct: 57 AEILD 61

>gi|254781055|ref|YP_003065468.1| glutathione reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Back     alignment
 Score = 32.0 bits (71), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 6  YDVIVIGGGHAGCEAAAVAAKLGASTAL 33
          YD++VIG G +G  +A +AA+LG   A+
Sbjct: 5  YDLVVIGAGSSGVRSARLAAQLGKKVAI 32

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target626 tRNA uridine 5-carboxymethylaminomethyl modification en
315122031625 tRNA uridine 5-carboxymethylaminomethyl modification en 1 0.0
15967090623 tRNA uridine 5-carboxymethylaminomethyl modification en 1 0.0
150398396623 tRNA uridine 5-carboxymethylaminomethyl modification en 1 0.0
307316117623 glucose inhibited division protein A [Sinorhizobium mel 1 0.0
227823855627 tRNA uridine 5-carboxymethylaminomethyl modification en 1 0.0
222087928626 glucose inhibited division protein A [Agrobacterium rad 1 0.0
209551501625 tRNA uridine 5-carboxymethylaminomethyl modification en 1 0.0
222150245621 tRNA uridine 5-carboxymethylaminomethyl modification en 1 0.0
190893978625 glucose inhibited division protein A [Rhizobium etli CI 1 0.0
327191201625 glucose inhibited division protein A [Rhizobium etli CN 1 0.0
>gi|315122031|ref|YP_004062520.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 625 Back     alignment and organism information
 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/625 (84%), Positives = 579/625 (92%), Gaps = 1/625 (0%)

Query: 1   MINRSYDVIVIGGGHAGCEAAAVAAKLGASTALITHKTSTIGSMSCNPAIGGLGKGHLVR 60
           M+   YDVIVIGGGHAGCEAA+ AA++GASTALITHK STIGSMSCNPAIGGLGKGHLVR
Sbjct: 1   MLKSCYDVIVIGGGHAGCEAASAAARIGASTALITHKISTIGSMSCNPAIGGLGKGHLVR 60

Query: 61  EIDALDGLMGRVADAAGIQFRVLNVKKGPAVRGPRTQADRELYRLAMQREILSQENLDVI 120
           EIDALDGLMGRVADA+GIQFR+LN+KKGPAVRGPRTQADRELYRLAMQREILSQEN+DVI
Sbjct: 61  EIDALDGLMGRVADASGIQFRILNIKKGPAVRGPRTQADRELYRLAMQREILSQENIDVI 120

Query: 121 QGEVAGFNTEKNIISSIVMQDNSMIRCSTVVLTTGTFLRGVIHIGKLKIPAGRMGDSPSN 180
           QGEV  FN + + ISSI+MQD +MIRCST+VLTTGTFLRG+I+IGK KIPAGRMGD PSN
Sbjct: 121 QGEVTDFNVKDDKISSILMQDGTMIRCSTLVLTTGTFLRGIIYIGKSKIPAGRMGDPPSN 180

Query: 181 SLFNSFMKFDFDTGRLKTGTPARLDGKTIIWDKTEKQFADERLIPFSFMTDKITNRQIEC 240
            LFNSFM+FDFD GRLKTGTPARLDG+TIIW+KTEKQ+AD+ L+PFSFMTDKITN+QI C
Sbjct: 181 CLFNSFMQFDFDMGRLKTGTPARLDGRTIIWEKTEKQYADKNLVPFSFMTDKITNKQIAC 240

Query: 241 GITRTNLETHRIIMENIKHSAIYSGDIKSYGPRYCPSIEDKIVRFGERNGHQIFLEPEGL 300
           GITRTN ETHRII ENIKHS+IYSGDIKS GPRYCPSIEDKI+RFGERNGHQ+FLEPEGL
Sbjct: 241 GITRTNFETHRIITENIKHSSIYSGDIKSRGPRYCPSIEDKIIRFGERNGHQVFLEPEGL 300

Query: 301 NTDVVYPNGISTALPEEIQHQFIRTIPGLEKVNIIRPGYAIEYDYINPKELFPTLETKKI 360
            T VVYPNGISTALPEEIQHQFIRTIPGLEKV II PGYAIEYDY+NP+EL+PTLETKKI
Sbjct: 301 CTHVVYPNGISTALPEEIQHQFIRTIPGLEKVEIISPGYAIEYDYVNPEELYPTLETKKI 360

Query: 361 SGLFLAGQINGTTGYEEAAAQGLVAGINSARKSNKLDCICFSRTDSYIGVMIDDLTSKGV 420
           +GLFLAGQINGTTGYEEAAAQGLVAGINSARKS  LDC+CFSRTDSYIGVMIDDLTSKGV
Sbjct: 361 TGLFLAGQINGTTGYEEAAAQGLVAGINSARKSKGLDCVCFSRTDSYIGVMIDDLTSKGV 420

Query: 421 LEPYRMFTSRAEYRISLRPDNADNRLTPIGMKLGCIGERRQKRFAKYIQEYNFLRSLLKS 480
           +EPYRMFTSRAEYR+SLR +NADNRLTPIGM+LGCIG+ R++RF  YIQEYN LR LLKS
Sbjct: 421 VEPYRMFTSRAEYRLSLRTENADNRLTPIGMELGCIGKERRERFKNYIQEYNLLRDLLKS 480

Query: 481 LVLTSKNLSSTSISFKQDGKTRTAYEFLSYPDFSIQNLFSICPDARKFSSLVIERLQIES 540
           +++TSKN++STSI  KQDGK R AY+ LSYPDFSI+NLFSI PDA KFSS+V+ERL+IES
Sbjct: 481 VIITSKNIASTSIPLKQDGKIRNAYDLLSYPDFSIKNLFSIYPDACKFSSIVLERLKIES 540

Query: 541 SYAAYTGRQMIEAKEIKFEEKRLIPKDFDYSSLPALSNELKEKLSILKPFNLLQASKIEG 600
           SY  YT RQM+EAKEIKFEEKRLIP DFDYSSLPALSNELKEKLS +KPFNLLQASKIEG
Sbjct: 541 SYDVYTKRQMVEAKEIKFEEKRLIPNDFDYSSLPALSNELKEKLSCVKPFNLLQASKIEG 600

Query: 601 MTPAALNLLLIYIKKNT-VKLNEIV 624
           MTPAALNLLLIYIKKNT +K N++V
Sbjct: 601 MTPAALNLLLIYIKKNTSIKENKMV 625


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15967090|ref|NP_387443.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Sinorhizobium meliloti 1021] Length = 623 Back     alignment and organism information
>gi|150398396|ref|YP_001328863.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Sinorhizobium medicae WSM419] Length = 623 Back     alignment and organism information
>gi|307316117|ref|ZP_07595561.1| glucose inhibited division protein A [Sinorhizobium meliloti AK83] Length = 623 Back     alignment and organism information
>gi|227823855|ref|YP_002827828.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Sinorhizobium fredii NGR234] Length = 627 Back     alignment and organism information
>gi|222087928|ref|YP_002546466.1| glucose inhibited division protein A [Agrobacterium radiobacter K84] Length = 626 Back     alignment and organism information
>gi|209551501|ref|YP_002283418.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 625 Back     alignment and organism information
>gi|222150245|ref|YP_002551202.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Agrobacterium vitis S4] Length = 621 Back     alignment and organism information
>gi|190893978|ref|YP_001980520.1| glucose inhibited division protein A [Rhizobium etli CIAT 652] Length = 625 Back     alignment and organism information
>gi|327191201|gb|EGE58244.1| glucose inhibited division protein A [Rhizobium etli CNPAF512] Length = 625 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target626 tRNA uridine 5-carboxymethylaminomethyl modification en
KOG2311679 KOG2311, KOG2311, KOG2311, NAD/FAD-utilizing protein po 0.0
PRK05192618 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminome 0.0
TIGR00136617 TIGR00136, gidA, glucose-inhibited division protein A 0.0
COG0445621 COG0445, GidA, NAD/FAD-utilizing enzyme apparently invo 0.0
pfam01134391 pfam01134, GIDA, Glucose inhibited division protein A 0.0
PRK05335436 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase 1e-16
COG1206439 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involv 9e-16
TIGR00137433 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransferase 7e-14
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 4e-07
PRK05335436 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase 6e-07
COG1206439 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involv 7e-07
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 4e-06
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase 4e-05
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subun 1e-04
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 4e-04
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide reducta 6e-04
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydrox 8e-04
KOG0405478 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphi 0.004
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehy 2e-06
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 6e-06
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 5e-05
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 6e-05
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 6e-05
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 8e-05
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 8e-05
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and related pr 2e-04
TIGR01350461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 2e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General func 3e-04
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 3e-04
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Rev 3e-04
TIGR01812566 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or f 5e-04
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 7e-04
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reductase; R 9e-04
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 0.001
COG3075421 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydroge 0.002
PRK07803626 PRK07803, sdhA, succinate dehydrogenase flavoprotein su 0.002
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydrogenase; 0.003
TIGR00137433 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransferase 2e-05
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-04
COG2303542 COG2303, BetA, Choline dehydrogenase and related flavop 0.004
>gnl|CDD|37522 KOG2311, KOG2311, KOG2311, NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179960 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>gnl|CDD|129242 TIGR00136, gidA, glucose-inhibited division protein A Back     alignment and domain information
>gnl|CDD|30794 COG0445, GidA, NAD/FAD-utilizing enzyme apparently involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|144651 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|180023 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>gnl|CDD|31399 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129243 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180023 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>gnl|CDD|31399 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|163151 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|35626 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|180019 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|146239 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|162542 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181141 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|32889 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183786 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|129243 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>gnl|CDD|162675 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|32458 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 626 tRNA uridine 5-carboxymethylaminomethyl modification en
PRK05192621 tRNA uridine 5-carboxymethylaminomethyl modification en 100.0
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 100.0
KOG2311679 consensus 100.0
TIGR00136630 gidA glucose-inhibited division protein A; InterPro: IP 100.0
pfam01134391 GIDA Glucose inhibited division protein A. 100.0
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 100.0
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 100.0
COG2081408 Predicted flavoproteins [General function prediction on 99.28
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 98.25
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 98.23
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 98.13
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 97.76
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 96.82
KOG4716503 consensus 96.75
PRK12775993 putative trifunctional 2-polyprenylphenol hydroxylase/g 96.36
TIGR02061651 aprA adenylylsulfate reductase, alpha subunit; InterPro 96.06
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 95.6
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 100.0
TIGR01812636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 98.84
TIGR01816615 sdhA_forward succinate dehydrogenase, flavoprotein subu 98.7
TIGR01176585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 90.48
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.41
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.3
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.29
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.29
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.27
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.92
PRK12842567 putative succinate dehydrogenase; Reviewed 98.82
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.79
PRK12839574 hypothetical protein; Provisional 98.79
PRK12843576 putative FAD-binding dehydrogenase; Reviewed 98.73
PRK06134579 putative FAD-binding dehydrogenase; Reviewed 98.72
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.64
PRK12845566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.48
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 98.3
PRK02106555 choline dehydrogenase; Validated 98.09
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 98.08
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.07
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 98.06
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.0
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 97.97
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 97.96
PRK07208474 hypothetical protein; Provisional 97.85
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 97.72
KOG0029501 consensus 97.66
PRK06184503 hypothetical protein; Provisional 97.65
PRK11883452 protoporphyrinogen oxidase; Reviewed 97.58
PRK07233430 hypothetical protein; Provisional 97.55
PRK08244494 hypothetical protein; Provisional 97.47
PRK08294634 phenol 2-monooxygenase; Provisional 97.43
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 97.36
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 97.35
PRK07190480 hypothetical protein; Provisional 97.26
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 97.26
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 96.96
KOG0042680 consensus 96.91
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 96.83
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 96.81
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 96.8
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 96.78
COG3349485 Uncharacterized conserved protein [Function unknown] 96.75
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 96.74
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 96.63
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production and c 96.61
PRK12416466 protoporphyrinogen oxidase; Provisional 96.37
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.26
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.22
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.98
PRK07660283 consensus 95.95
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.86
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.86
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 95.79
pfam00996439 GDI GDP dissociation inhibitor. 95.74
KOG1238623 consensus 95.7
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.7
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 95.34
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 95.23
PRK09117282 consensus 94.89
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.76
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 94.72
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 94.45
TIGR02279508 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; I 94.44
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 94.43
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.43
KOG1276491 consensus 94.4
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.39
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 94.29
PRK12770350 putative glutamate synthase subunit beta; Provisional 94.06
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 93.78
PRK12831464 putative oxidoreductase; Provisional 93.78
COG2907447 Predicted NAD/FAD-binding protein [General function pre 93.65
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 93.38
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.26
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 93.15
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 93.14
KOG4405547 consensus 92.89
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.86
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 92.73
KOG1439440 consensus 92.35
PRK08229341 2-dehydropantoate 2-reductase; Provisional 92.29
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 92.14
KOG2853509 consensus 92.03
KOG0685498 consensus 91.89
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 91.65
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 91.43
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 91.3
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 91.09
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 91.08
PRK11749460 putative oxidoreductase; Provisional 91.0
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.87
) and pyridine nucleotide transhydrogenase () have been shown to share regions of similarity . Alanine dehydrogenase catalyzes the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyzes the reduction of NADP^+ to NADPH with the concomitant oxidation of NADH to NAD^+. This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation between NADH and NADP is coupled with the translocation of a proton across the membrane. In prokaryotes the enzyme is composed of two different subunits, an alpha chain (gene pntA) and a beta chain (gene pntB), while in eukaryotes it is a single chain protein. The sequence of alanine dehydrogenase from several bacterial species are related with those of the alpha subunit of bacterial pyridine nucleotide transhydrogenase and of the N-terminal half of the eukaryotic enzyme. The two most conserved regions correspond respectively to the N-terminal extremity of these proteins and to a central glycine-rich region which is part of the NAD(H)-binding site.; GO: 0000286 alanine dehydrogenase activity, 0006118 electron transport." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00518">TIGR00518372 alaDH alanine dehydrogenase; InterPro: IPR008141 Alanin 90.44
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.23
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 90.22
KOG1336478 consensus 90.15
PRK07803631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.34
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.32
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 99.3
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.29
PRK09077535 L-aspartate oxidase; Provisional 99.28
PRK06854610 adenylylsulfate reductase; Validated 99.28
PTZ00139622 succinate dehydrogenase (flavoprotein) subunit; Provisi 99.26
PRK08275554 putative oxidoreductase; Provisional 99.23
pfam03486405 HI0933_like HI0933-like protein. 99.2
PRK06069582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.19
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.16
PRK06263539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.12
PRK10157428 putative oxidoreductase FixC; Provisional 99.1
PRK05976464 dihydrolipoamide dehydrogenase; Validated 99.1
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.07
PRK07573638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.06
PRK07395556 L-aspartate oxidase; Provisional 99.05
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.01
PTZ00052541 thioredoxin reductase; Provisional 99.0
PRK06370459 mercuric reductase; Validated 99.0
PRK06116450 glutathione reductase; Validated 99.0
PRK10015429 hypothetical protein; Provisional 99.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.0
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 98.99
PRK06175433 L-aspartate oxidase; Provisional 98.98
PRK10262321 thioredoxin reductase; Provisional 98.97
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 98.95
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 98.94
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 98.94
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.93
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 98.91
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.9
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 98.89
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.89
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 98.89
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.88
PRK13748561 putative mercuric reductase; Provisional 98.85
PRK08274456 tricarballylate dehydrogenase; Validated 98.83
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.81
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 98.8
PRK07512507 L-aspartate oxidase; Provisional 98.79
PRK11259377 solA N-methyltryptophan oxidase; Provisional 98.79
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 98.77
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 98.76
PRK07121491 hypothetical protein; Validated 98.76
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 98.75
PRK07845467 flavoprotein disulfide reductase; Reviewed 98.74
PRK08401464 L-aspartate oxidase; Provisional 98.74
KOG1298509 consensus 98.73
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 98.72
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 98.71
PRK07608389 hypothetical protein; Provisional 98.7
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.69
PRK07045388 putative monooxygenase; Reviewed 98.69
PRK09126392 hypothetical protein; Provisional 98.69
PRK06185409 hypothetical protein; Provisional 98.67
PRK12837515 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.66
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 98.66
PRK08071510 L-aspartate oxidase; Provisional 98.65
KOG2820399 consensus 98.65
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 98.65
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 98.64
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 98.63
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.59
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 98.59
PRK08013400 hypothetical protein; Provisional 98.58
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.57
PRK08774402 consensus 98.56
PRK07804533 L-aspartate oxidase; Provisional 98.55
PRK11445348 putative oxidoreductase; Provisional 98.54
PRK07846453 mycothione/glutathione reductase; Reviewed 98.52
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 98.49
PRK08163396 salicylate hydroxylase; Provisional 98.4
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.36
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 98.36
PRK11728400 hypothetical protein; Provisional 98.35
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 98.34
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 98.33
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 98.32
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 98.31
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 98.31
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.3
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.29
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 98.28
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.25
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.23
PRK06834488 hypothetical protein; Provisional 98.23
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 98.18
PRK04965378 nitric oxide reductase; Provisional 98.18
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 98.17
PRK07236386 hypothetical protein; Provisional 98.16
PRK08948392 consensus 98.16
PRK06126545 hypothetical protein; Provisional 98.15
COG0579429 Predicted dehydrogenase [General function prediction on 98.13
PTZ00153673 lipoamide dehydrogenase; Provisional 98.11
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 98.01
PRK06475400 salicylate hydroxylase; Provisional 98.0
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 97.99
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 97.93
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 97.87
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 97.86
KOG1335506 consensus 97.86
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 97.8
PRK06847375 hypothetical protein; Provisional 97.78
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.77
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 97.77
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.76
PRK06996397 hypothetical protein; Provisional 97.74
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.7
PRK07538413 hypothetical protein; Provisional 97.69
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 97.69
PRK05868372 hypothetical protein; Validated 97.69
PRK08132549 hypothetical protein; Provisional 97.68
KOG2614420 consensus 97.62
PRK13512438 coenzyme A disulfide reductase; Provisional 97.59
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 97.59
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 97.55
PRK07588391 hypothetical protein; Provisional 97.54
PRK06753373 hypothetical protein; Provisional 97.5
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.5
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 97.46
KOG2404477 consensus 97.44
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 97.31
TIGR01811620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 97.05
TIGR02374813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 97.04
COG4529474 Uncharacterized protein conserved in bacteria [Function 97.02
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 96.94
KOG1399448 consensus 96.65
PTZ00318514 NADH dehydrogenase; Provisional 96.54
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 96.53
KOG2852380 consensus 96.46
KOG2844 856 consensus 96.02
KOG0405478 consensus 95.96
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 95.83
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 95.64
PRK13512438 coenzyme A disulfide reductase; Provisional 95.34
KOG0404322 consensus 95.3
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 95.23
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 94.98
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 94.79
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 94.59
PRK04965378 nitric oxide reductase; Provisional 93.76
KOG2960328 consensus 92.65
PRK08626657 fumarate reductase flavoprotein subunit; Provisional 99.33
PRK11749460 putative oxidoreductase; Provisional 98.47
PTZ003061167 NADH-dependent fumarate reductase; Provisional 98.45
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 98.34
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.87
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 97.52
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.45
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 97.44
PRK07846453 mycothione/glutathione reductase; Reviewed 97.3
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.26
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.21
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.07
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 96.41
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 96.17
PRK06370459 mercuric reductase; Validated 96.08
PTZ00052541 thioredoxin reductase; Provisional 96.02
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 95.97
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 95.9
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 95.9
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 95.86
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 95.84
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 95.79
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 95.69
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 94.9
PRK13748561 putative mercuric reductase; Provisional 94.53
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 92.75
PRK10262321 thioredoxin reductase; Provisional 91.99
PTZ00153673 lipoamide dehydrogenase; Provisional 90.77
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.72
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 98.62
COG3573552 Predicted oxidoreductase [General function prediction o 97.03
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 96.87
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 98.64
TIGR00551546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 98.37
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 98.32
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 97.75
COG2303542 BetA Choline dehydrogenase and related flavoproteins [A 97.52
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 96.86
KOG4254561 consensus 96.09
PTZ00318514 NADH dehydrogenase; Provisional 95.08
KOG3855481 consensus 91.23
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 98.19
PRK05976464 dihydrolipoamide dehydrogenase; Validated 97.5
PRK12814652 putative NADPH-dependent glutamate synthase small subun 97.32
PRK12770350 putative glutamate synthase subunit beta; Provisional 97.87
PRK12831464 putative oxidoreductase; Provisional 97.5
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.12
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 97.86
PRK13984604 putative oxidoreductase; Provisional 97.37
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 97.27
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.21
PRK098531032 putative selenate reductase subunit YgfK; Provisional 97.18
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 97.16
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 97.12
PRK12779944 putative bifunctional glutamate synthase subunit beta/2 96.42
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 95.83
PRK12814652 putative NADPH-dependent glutamate synthase small subun 92.42
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 91.61
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 97.63
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 95.62
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 94.75
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 94.31
PRK08277278 D-mannonate oxidoreductase; Provisional 90.77
PRK06116450 glutathione reductase; Validated 97.5
PRK06327475 dihydrolipoamide dehydrogenase; Validated 95.46
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 95.1
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 94.5
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 92.27
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 90.5
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2311 consensus Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A; InterPro: IPR004416 Glucose-inhibited division protein A, GidA appears to be present in all complete eubacterial genomes so far, as well as Saccharomyces cerevisiae Back     alignment and domain information
>pfam01134 GIDA Glucose inhibited division protein A Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase; InterPro: IPR005982 Reactive oxygen species (ROS) are known mediators of intracellular signaling cascades Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR012831 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG4716 consensus Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR02061 aprA adenylylsulfate reductase, alpha subunit; InterPro: IPR011803 During dissimilatory sulphate reduction or sulphur oxidation, adenylylsulphate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulphite and AMP Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase; InterPro: IPR006338 This homodimeric, FAD-containing member of the pyridine nucleotide disulphide oxidoreductase family contains a C-terminal motif Cys-SeCys-Gly, where SeCys is selenocysteine encoded by TGA (in some sequence reports interpreted as a stop codon) Back     alignment and domain information
>TIGR00137 gid gid protein; InterPro: IPR004417 The gid proteins are present in relatively few bacteria but very tightly conserved where they occur Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunit; InterPro: IPR014006 Succinate:quinone oxidoreductase (1 Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit; InterPro: IPR011281 Succinate dehydrogenase and fumarate reductase are homologous enzymes reversible in principle but favoured under different circumstances Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit; InterPro: IPR005884 In bacteria two distinct, membrane-bound, enzyme complexes are responsible for the interconversion of fumarate and succinate (1 Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>KOG0029 consensus Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: IPR004379 UDP-galactopyranose mutase (5 Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 Members of this family are encoded by slr1293, a carotenoid biosynthesis protein which was shown to be the C-3',4' desaturase (CrtD) of myxoxanthophyll biosynthesis in Synechocystis sp Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase; InterPro: IPR014101 Members of this family, including sll0033 (crtH) of Synechocystis sp Back     alignment and domain information
>pfam00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>KOG0042 consensus Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase; InterPro: IPR011774 This entry represents the reductase which acts reduces the geranylgeranyl group to the phytyl group in the side chain of chlorophyll Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07660 consensus Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00996 GDI GDP dissociation inhibitor Back     alignment and domain information
>KOG1238 consensus Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterPro: IPR000689 Ubiquinone (Q) functions as an electron carrier in the respiratory chain in mitochondria Back     alignment and domain information
>PRK09117 consensus Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>pfam02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; InterPro: IPR011967 This 3-hydroxyacyl-CoA dehydrogenase is involved in the degradation of phenylacetic acid, presumably in steps following the opening of the phenyl ring Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR014103 Carotene 7,8-desaturase, also called zeta-carotene desaturase, catalyses multiple steps in the pathway from geranylgeranyl-PP to all-trans-lycopene in plants and cyanobacteria Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1276 consensus Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase; InterPro: IPR006324 These sequences represent glutathione reductases of plants and some bacteria, including cyanobacteria Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1 Back     alignment and domain information
>KOG4405 consensus Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain Back     alignment and domain information
>KOG1439 consensus Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG2853 consensus Back     alignment and domain information
>KOG0685 consensus Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>pfam06039 Mqo Malate:quinone oxidoreductase (Mqo) Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11749 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase; InterPro: IPR008141 Alanine dehydrogenases (Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>pfam00743 FMO-like Flavin-binding monooxygenase-like Back     alignment and domain information
>KOG1336 consensus Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase; Validated Back     alignment and domain information
>PTZ00139 succinate dehydrogenase (flavoprotein) subunit; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>pfam03486 HI0933_like HI0933-like protein Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information