254780828

254780828

ATP-dependent protease peptidase subunit

GeneID in NCBI database:8209834Locus tag:CLIBASIA_03605
Protein GI in NCBI database:254780828Protein Accession:YP_003065241.1
Gene range:-(419913, 420485)Protein Length:190aa
Gene description:ATP-dependent protease peptidase subunit
COG prediction:none
KEGG prediction:ATP-dependent protease peptidase subunit (EC:3.4.25.-); K01419 ATP-dependent HslUV protease, peptidase subunit HslV [EC:3.4.25.-]
SEED prediction:ATP-dependent protease HslV (EC 3.4.25.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteasome bacterial;
Proteolysis in bacteria, ATP-dependent
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE
cEEEccccccccccEEEEEEEEEccEEEEEcccccccHHHHEEccccEEEEcccccEEEEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEccccEEcccccEEEEEccHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEcccEEEEEEEcccc
cEEEcccccccccccccEEEEEEccEEEEEEcccEEEccEEEEcccccEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHcccEEEEEccccEEEEcccccEEcccccEEEEcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccEEEEEccccc
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKgniiagfagssADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGmgdvlepengvmaigsgGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE
mvvmgdkhyaVKMHATtiltvrkdgVVVIAGdgqvslgqtvmKANARKVRRLGKGniiagfagssaDAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE
**************ATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLK****
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKV***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE
MVVMGDKHYAVKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target190 ATP-dependent protease peptidase subunit [Candidatus Li
315122052189 ATP-dependent protease peptidase subunit [Candidatus Li 1 2e-85
110635820182 ATP-dependent protease peptidase subunit [Mesorhizobium 1 4e-78
306842804211 ATP-dependent protease peptidase subunit [Brucella sp. 1 2e-77
225626460184 ATP-dependent protease hslV [Brucella ceti str. Cudo] L 1 2e-77
62290924184 ATP-dependent protease peptidase subunit [Brucella abor 1 2e-77
23502928184 ATP-dependent protease peptidase subunit [Brucella suis 1 2e-77
254713515184 ATP-dependent protease peptidase subunit [Brucella ceti 1 5e-77
17988330184 ATP-dependent protease peptidase subunit [Brucella meli 1 6e-77
148559699184 ATP-dependent protease peptidase subunit [Brucella ovis 1 7e-77
239833122184 ATP-dependent protease hslV [Ochrobactrum intermedium L 1 2e-76
>gi|315122052|ref|YP_004062541.1| ATP-dependent protease peptidase subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 189 Back     alignment and organism information
 Score =  318 bits (816), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%)

Query: 11  VKMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFT 70
           VKMHATTILTVRK G+VVIA DGQVS+G TVMK NARKVRRLGKGNIIAGFAGSSADAFT
Sbjct: 11  VKMHATTILTVRKGGIVVIASDGQVSVGNTVMKGNARKVRRLGKGNIIAGFAGSSADAFT 70

Query: 71  LLERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEP 130
           L+E+LEKKLEQYP QLLR+SVEL KDWR DKYLRNLEAMIL+ADKT+TLVITG GDVLEP
Sbjct: 71  LVEKLEKKLEQYPGQLLRASVELTKDWRADKYLRNLEAMILVADKTVTLVITGAGDVLEP 130

Query: 131 ENGVMAIGSGGSYALSAARALMSTQNSAEEIARKAMSIAADICVYTNHNIVLETLKV 187
           E+GVMAIGSGGSYAL+AARALM+TQ SAEEIAR+AMSIAADICVYTNH I+LETL+V
Sbjct: 131 EHGVMAIGSGGSYALAAARALMNTQKSAEEIAREAMSIAADICVYTNHEIILETLEV 187


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635820|ref|YP_676028.1| ATP-dependent protease peptidase subunit [Mesorhizobium sp. BNC1] Length = 182 Back     alignment and organism information
>gi|306842804|ref|ZP_07475444.1| ATP-dependent protease peptidase subunit [Brucella sp. BO2] Length = 211 Back     alignment and organism information
>gi|225626460|ref|ZP_03784499.1| ATP-dependent protease hslV [Brucella ceti str. Cudo] Length = 184 Back     alignment and organism information
>gi|62290924|ref|YP_222717.1| ATP-dependent protease peptidase subunit [Brucella abortus bv. 1 str. 9-941] Length = 184 Back     alignment and organism information
>gi|23502928|ref|NP_699055.1| ATP-dependent protease peptidase subunit [Brucella suis 1330] Length = 184 Back     alignment and organism information
>gi|254713515|ref|ZP_05175326.1| ATP-dependent protease peptidase subunit [Brucella ceti M644/93/1] Length = 184 Back     alignment and organism information
>gi|17988330|ref|NP_540964.1| ATP-dependent protease peptidase subunit [Brucella melitensis bv. 1 str. 16M] Length = 184 Back     alignment and organism information
>gi|148559699|ref|YP_001259885.1| ATP-dependent protease peptidase subunit [Brucella ovis ATCC 25840] Length = 184 Back     alignment and organism information
>gi|239833122|ref|ZP_04681451.1| ATP-dependent protease hslV [Ochrobactrum intermedium LMG 3301] Length = 184 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target190 ATP-dependent protease peptidase subunit [Candidatus Li
PRK05456172 PRK05456, PRK05456, ATP-dependent protease subunit HslV 1e-91
TIGR03692171 TIGR03692, ATP_dep_HslV, ATP-dependent protease HslVU, 7e-85
COG5405178 COG5405, HslV, ATP-dependent protease HslVU (ClpYQ), pe 1e-71
pfam00227188 pfam00227, Proteasome, Proteasome subunit 1e-24
cd01906182 cd01906, proteasome_protease_HslV, proteasome_protease_ 2e-24
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal 3e-15
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 2e-09
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subunits 1e-08
cd03762188 cd03762, proteasome_beta_type_6, proteasome beta type-6 5e-07
KOG0185256 KOG0185, KOG0185, KOG0185, 20S proteasome, regulatory s 2e-04
KOG0174224 KOG0174, KOG0174, KOG0174, 20S proteasome, regulatory s 0.002
cd01913171 cd01913, protease_HslV, Protease HslV and the ATPase/ch 2e-75
cd03757212 cd03757, proteasome_beta_type_1, proteasome beta type-1 3e-04
KOG0179235 KOG0179, KOG0179, KOG0179, 20S proteasome, regulatory s 0.003
>gnl|CDD|180095 PRK05456, PRK05456, ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>gnl|CDD|163404 TIGR03692, ATP_dep_HslV, ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>gnl|CDD|34964 COG5405, HslV, ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|143982 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|48439 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|48436 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|48441 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|30983 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48460 cd03762, proteasome_beta_type_6, proteasome beta type-6 subunit Back     alignment and domain information
>gnl|CDD|35406 KOG0185, KOG0185, KOG0185, 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35395 KOG0174, KOG0174, KOG0174, 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48442 cd01913, protease_HslV, Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>gnl|CDD|48455 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit Back     alignment and domain information
>gnl|CDD|35400 KOG0179, KOG0179, KOG0179, 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 190 ATP-dependent protease peptidase subunit [Candidatus Li
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subunit. 100.0
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subunit. 100.0
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subunit. 100.0
KOG0175285 consensus 100.0
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subunit. 100.0
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subunit. 100.0
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subunit. 100.0
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, archae 100.0
cd03764188 proteasome_beta_archeal Archeal proteasome, beta subuni 100.0
KOG0179235 consensus 100.0
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subunit. 100.0
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Posttrans 100.0
pfam00227188 Proteasome Proteasome subunit. The proteasome is a mult 100.0
cd01912189 proteasome_beta proteasome beta subunit. The 20S protea 100.0
cd01913171 protease_HslV Protease HslV and the ATPase/chaperone Hs 100.0
PRK05456172 ATP-dependent protease peptidase subunit; Provisional 100.0
KOG0173271 consensus 99.98
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptidase su 99.97
TIGR03633229 arc_protsome_A proteasome endopeptidase complex, archae 99.97
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. The 99.97
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. The 20 99.97
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. This 99.97
PRK03996245 proteasome subunit alpha; Provisional 99.96
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S prot 99.96
PTZ00246253 proteasome subunit alpha; Provisional 99.96
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. The 20 99.96
KOG0174224 consensus 99.96
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. The 20 99.96
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. The 20 99.96
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. The 20 99.95
KOG0180204 consensus 99.95
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. The 20 99.94
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. The 20 99.94
KOG0185256 consensus 99.89
KOG0176241 consensus 99.82
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophil 99.76
KOG0177200 consensus 99.75
KOG0178249 consensus 99.64
KOG0184254 consensus 99.59
KOG0183249 consensus 99.55
KOG0863264 consensus 99.5
KOG0181233 consensus 99.45
KOG0182246 consensus 99.02
cd03765236 proteasome_beta_bacterial Bacterial proteasome, beta su 98.23
COG3484255 Predicted proteasome-type protease [Posttranslational m 96.68
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>KOG0175 consensus Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>KOG0179 consensus Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam00227 Proteasome Proteasome subunit Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>PRK05456 ATP-dependent protease peptidase subunit; Provisional Back     alignment and domain information
>KOG0173 consensus Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>KOG0174 consensus Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>KOG0180 consensus Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>KOG0185 consensus Back     alignment and domain information
>KOG0176 consensus Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>KOG0177 consensus Back     alignment and domain information
>KOG0178 consensus Back     alignment and domain information
>KOG0184 consensus Back     alignment and domain information
>KOG0183 consensus Back     alignment and domain information
>KOG0863 consensus Back     alignment and domain information
>KOG0181 consensus Back     alignment and domain information
>KOG0182 consensus Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target190 ATP-dependent protease peptidase subunit [Candidatus Li
1ned_A183 Crystal Structure Of Hslv (Clpq) At 3.8 Angstroms R 3e-44
1e94_A175 Hslv-Hslu From E.Coli Length = 175 6e-44
1g3i_G174 Crystal Structure Of The Hsluv Protease-Chaperone C 2e-42
1m4y_A171 Crystal Structure Of Hslv From Thermotoga Maritima 4e-41
2z3a_A180 Crystal Structure Of Bacillus Subtilis Codw, A Non- 5e-41
1yyf_D181 Correction Of X-Ray Intensities From An Hslv-Hslu C 1e-40
3nzj_K287 Crystal Structure Of Yeast 20s Proteasome In Comple 8e-31
1ryp_L212 Crystal Structure Of The 20s Proteasome From Yeast 9e-28
1g0u_K212 A Gated Channel Into The Proteasome Core Particle L 9e-28
1g65_K211 Crystal Structure Of Epoxomicin:20s Proteasome Reve 6e-27
1iru_L204 Crystal Structure Of The Mammalian 20s Proteasome A 8e-27
1iru_I234 Crystal Structure Of The Mammalian 20s Proteasome A 2e-25
1q5r_H294 The Rhodococcus 20s Proteasome With Unprocessed Pro 5e-25
2h6j_H294 Crystal Structure Of The Beta F145a Rhodococcus Pro 6e-25
3h4p_a219 Proteasome 20s Core Particle From Methanocaldococcu 9e-24
3nzj_H261 Crystal Structure Of Yeast 20s Proteasome In Comple 2e-23
1q5q_H235 The Rhodococcus 20s Proteasome Length = 235 5e-23
1ya7_H217 Implications For Interactions Of Proteasome With Pa 5e-23
1pma_B211 Proteasome From Thermoplasma Acidophilum Length = 2 5e-23
1ryp_I222 Crystal Structure Of The 20s Proteasome From Yeast 1e-22
1fnt_I232 Crystal Structure Of The 20s Proteasome From Yeast 2e-22
3c91_H203 Thermoplasma Acidophilum 20s Proteasome With An Ope 3e-22
2jay_A291 Proteasome Beta Subunit Prcb From Mycobacterium Tub 9e-22
1j2q_H202 20s Proteasome In Complex With Calpain-Inhibitor I 9e-22
1iru_M213 Crystal Structure Of The Mammalian 20s Proteasome A 2e-21
3mka_C291 Crystal Structure Of Mycobacterium Tuberculosis Pro 8e-21
2fhg_H240 Crystal Structure Of Mycobacterial Tuberculosis Pro 1e-18
1ryp_J204 Crystal Structure Of The 20s Proteasome From Yeast 1e-18
1g0u_I205 A Gated Channel Into The Proteasome Core Particle L 1e-18
1iru_H205 Crystal Structure Of The Mammalian 20s Proteasome A 1e-18
3h6f_C240 Crystal Structure Of Mycobacterium Tuberculosis Pro 7e-18
3nzj_N215 Crystal Structure Of Yeast 20s Proteasome In Comple 2e-16
1iru_J205 Crystal Structure Of The Mammalian 20s Proteasome A 4e-16
1ryp_H205 Crystal Structure Of The 20s Proteasome From Yeast 1e-15
1g65_N196 Crystal Structure Of Epoxomicin:20s Proteasome Reve 1e-15
1vsy_H196 Proteasome Activator Complex Length = 196 8e-15
3h4p_A264 Proteasome 20s Core Particle From Methanocaldococcu 1e-13
1g0u_L241 A Gated Channel Into The Proteasome Core Particle L 2e-11
1ryp_M222 Crystal Structure Of The 20s Proteasome From Yeast 2e-11
1ryp_G244 Crystal Structure Of The 20s Proteasome From Yeast 5e-11
1g0u_F248 A Gated Channel Into The Proteasome Core Particle L 7e-11
1fnt_G287 Crystal Structure Of The 20s Proteasome From Yeast 9e-11
1z7q_G288 Crystal Structure Of The 20s Proteasome From Yeast 1e-10
1iru_N219 Crystal Structure Of The Mammalian 20s Proteasome A 8e-10
1ryp_K198 Crystal Structure Of The 20s Proteasome From Yeast 9e-10
1g0u_M266 A Gated Channel Into The Proteasome Core Particle L 1e-08
1j2p_A246 Alpha-Ring From The Proteasome From Archaeoglobus F 2e-08
1j2q_A237 20s Proteasome In Complex With Calpain-Inhibitor I 2e-08
1ryp_N233 Crystal Structure Of The 20s Proteasome From Yeast 1e-07
1iru_E241 Crystal Structure Of The Mammalian 20s Proteasome A 2e-07
3jrm_A227 Crystal Structure Of Archaeal 20s Proteasome In Com 7e-07
1yar_A233 Structure Of Archeabacterial 20s Proteasome Mutant 8e-07
1yau_A233 Structure Of Archeabacterial 20s Proteasome- Pa26 C 8e-07
1pma_A233 Proteasome From Thermoplasma Acidophilum Length = 2 9e-07
2ku2_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 1e-06
2ku1_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 1e-06
1vsy_D227 Proteasome Activator Complex Length = 227 1e-06
1ryp_D241 Crystal Structure Of The 20s Proteasome From Yeast 1e-06
1g0u_C243 A Gated Channel Into The Proteasome Core Particle L 1e-06
1fnt_D254 Crystal Structure Of The 20s Proteasome From Yeast 1e-06
1iru_K201 Crystal Structure Of The Mammalian 20s Proteasome A 2e-05
1vsy_C232 Proteasome Activator Complex Length = 232 4e-05
1ryp_C244 Crystal Structure Of The 20s Proteasome From Yeast 4e-05
1g0u_B245 A Gated Channel Into The Proteasome Core Particle L 5e-05
1z7q_C258 Crystal Structure Of The 20s Proteasome From Yeast 5e-05
1iru_D248 Crystal Structure Of The Mammalian 20s Proteasome A 2e-04
1g0u_D241 A Gated Channel Into The Proteasome Core Particle L 2e-04
1iru_C261 Crystal Structure Of The Mammalian 20s Proteasome A 4e-04
1ryp_B250 Crystal Structure Of The 20s Proteasome From Yeast 0.002
1vsy_B231 Proteasome Activator Complex Length = 231 0.002
1ryp_E242 Crystal Structure Of The 20s Proteasome From Yeast 0.003
1vsy_E250 Proteasome Activator Complex Length = 250 0.004
2z5c_C262 Crystal Structure Of A Novel Chaperone Complex For 0.004
1fnt_E260 Crystal Structure Of The 20s Proteasome From Yeast 0.004
>gi|3114398|pdb|1NED|A Chain A, Crystal Structure Of Hslv (Clpq) At 3.8 Angstroms Resolution Length = 183 Back     alignment and structure
 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 104/176 (59%), Positives = 136/176 (77%), Gaps = 1/176 (0%)

Query: 16  TTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNIIAGFAGSSADAFTLLERL 75
           TTI++VR++G VVIAGDGQ +LG TVMK N +KVRRL    +IAGFAG +ADAFTL E  
Sbjct: 1   TTIVSVRRNGHVVIAGDGQATLGNTVMKGNVKKVRRLYNDKVIAGFAGGTADAFTLFELF 60

Query: 76  EKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVM 135
           E+KLE +   L++++VELAKDWR D+ LR LEA++ +AD+T +L+ITG GDV++PEN ++
Sbjct: 61  ERKLEMHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADETASLIITGNGDVVQPENDLI 120

Query: 136 AIGSGGSYALSAARALM-STQNSAEEIARKAMSIAADICVYTNHNIVLETLKVGDE 190
           AIGSGG YA +AARAL+ +T+ SA EIA KA+ IA DIC+YTNH   +E L    E
Sbjct: 121 AIGSGGPYAQAAARALLENTELSAREIAEKALDIAGDICIYTNHFHTIEELSYKAE 176


>gi|11513631|pdb|1E94|A Chain A, Hslv-Hslu From E.Coli Length = 175 Back     alignment and structure
>gi|11513574|pdb|1G3I|G Chain G, Crystal Structure Of The Hsluv Protease-Chaperone Complex Length = 174 Back     alignment and structure
>gi|30749448|pdb|1M4Y|A Chain A, Crystal Structure Of Hslv From Thermotoga Maritima Length = 171 Back     alignment and structure
>gi|170785086|pdb|2Z3A|A Chain A, Crystal Structure Of Bacillus Subtilis Codw, A Non- Canonical Hslv-Like Peptidase With An Impaired Catalytic Apparatus Length = 180 Back     alignment and structure
gi|73535734|pdb|1YYF|D Chain D, Correction Of X-Ray Intensities From An Hslv-Hslu Co- Crystal Containing Lattice Translocation Defects Length = 181 Back     alignment and structure
gi|323462946|pdb|3NZJ|K Chain K, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 287 Back     alignment and structure
>gi|3114280|pdb|1RYP|L Chain L, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 212 Back     alignment and structure
>gi|11514002|pdb|1G0U|K Chain K, A Gated Channel Into The Proteasome Core Particle Length = 212 Back     alignment and structure
>gi|11513423|pdb|1G65|K Chain K, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors Length = 211 Back     alignment and structure
>gi|21465653|pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 204 Back     alignment and structure
>gi|21465650|pdb|1IRU|I Chain I, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 234 Back     alignment and structure
>gi|40889405|pdb|1Q5R|H Chain H, The Rhodococcus 20s Proteasome With Unprocessed Pro-Peptides Length = 294 Back     alignment and structure
>gi|112491166|pdb|2H6J|H Chain H, Crystal Structure Of The Beta F145a Rhodococcus Proteasome (Casp Target) Length = 294 Back     alignment and structure
>gi|239782090|pdb|3H4P|AA Chain a, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 219 Back     alignment and structure
gi|323462943|pdb|3NZJ|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 261 Back     alignment and structure
>gi|40889391|pdb|1Q5Q|H Chain H, The Rhodococcus 20s Proteasome Length = 235 Back     alignment and structure
>gi|73535606|pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 Back     alignment and structure
gi|1633360|pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 Back     alignment and structure
>gi|3114277|pdb|1RYP|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 222 Back     alignment and structure
>gi|14488813|pdb|1FNT|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 232 Back     alignment and structure
>gi|195927408|pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 Back     alignment and structure
gi|167013196|pdb|2JAY|A Chain A, Proteasome Beta Subunit Prcb From Mycobacterium Tuberculosis Length = 291 Back     alignment and structure
>gi|29726328|pdb|1J2Q|H Chain H, 20s Proteasome In Complex With Calpain-Inhibitor I From Archaeoglobus Fulgidus Length = 202 Back     alignment and structure
>gi|21465654|pdb|1IRU|M Chain M, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 213 Back     alignment and structure
>gi|296863655|pdb|3MKA|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Proteasome With Propetide And An T1a Mutation At Beta-Subunit Length = 291 Back     alignment and structure
>gi|90109362|pdb|2FHG|H Chain H, Crystal Structure Of Mycobacterial Tuberculosis Proteasome Length = 240 Back     alignment and structure
>gi|3114278|pdb|1RYP|J Chain J, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 204 Back     alignment and structure
gi|11514000|pdb|1G0U|I Chain I, A Gated Channel Into The Proteasome Core Particle Length = 205 Back     alignment and structure
>gi|21465649|pdb|1IRU|H Chain H, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 205 Back     alignment and structure
>gi|258588387|pdb|3H6F|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Proteasome Modified By Inhibitor Ht1171 Length = 240 Back     alignment and structure
gi|323462949|pdb|3NZJ|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 215 Back     alignment and structure
>gi|21465651|pdb|1IRU|J Chain J, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 205 Back     alignment and structure
>gi|3114276|pdb|1RYP|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 205 Back     alignment and structure
>gi|11513426|pdb|1G65|N Chain N, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors Length = 196 Back     alignment and structure
>gi|298508229|pdb|1VSY|H Chain H, Proteasome Activator Complex Length = 196 Back     alignment and structure
>gi|239782083|pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 Back     alignment and structure
gi|11514003|pdb|1G0U|L Chain L, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>gi|3114281|pdb|1RYP|M Chain M, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 222 Back     alignment and structure
>gi|3114275|pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>gi|11513997|pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 Back     alignment and structure
>gi|14488811|pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 Back     alignment and structure
gi|75765705|pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 Back     alignment and structure
>gi|21465655|pdb|1IRU|N Chain N, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 219 Back     alignment and structure
gi|3114279|pdb|1RYP|K Chain K, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 198 Back     alignment and structure
gi|11514004|pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle Length = 266 Back     alignment and structure
>gi|29726314|pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 Back     alignment and structure
>gi|29726321|pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-Inhibitor I From Archaeoglobus Fulgidus Length = 237 Back     alignment and structure
>gi|3114282|pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 Back     alignment and structure
>gi|21465646|pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 Back     alignment and structure
>gi|262368047|pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 Back     alignment and structure
>gi|73535638|pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 Back     alignment and structure
>gi|73535659|pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 Back     alignment and structure
gi|1633359|pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 Back     alignment and structure
>gi|294979289|pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>gi|294979282|pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>gi|298508225|pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 Back     alignment and structure
>gi|3114272|pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 Back     alignment and structure
>gi|11513994|pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 Back     alignment and structure
gi|14488808|pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 Back     alignment and structure
gi|21465652|pdb|1IRU|K Chain K, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 201 Back     alignment and structure
>gi|298508224|pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 Back     alignment and structure
>gi|3114271|pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>gi|11513993|pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 Back     alignment and structure
gi|75765701|pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 Back     alignment and structure
gi|21465645|pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 Back     alignment and structure
>gi|11513995|pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
gi|21465644|pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 Back     alignment and structure
gi|3114270|pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 Back     alignment and structure
>gi|298508223|pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 Back     alignment and structure
>gi|3114273|pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 Back     alignment and structure
>gi|298508226|pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 Back     alignment and structure
>gi|166007290|pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 Back     alignment and structure
gi|14488809|pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target190 ATP-dependent protease peptidase subunit [Candidatus Li
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIle hyd 4e-44
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic threo 5e-42
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophi 2e-40
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosi 2e-23
1iru_N219 20S proteasome; cell cycle, immune response, proteolysi 8e-22
1iru_K201 20S proteasome; cell cycle, immune response, proteolysi 7e-21
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembly, Pr 9e-21
1ryp_J204 20S proteasome; multicatalytic proteinase, protein degr 2e-20
1ryp_M222 20S proteasome; multicatalytic proteinase, protein degr 3e-19
1iru_J205 20S proteasome; cell cycle, immune response, proteolysi 3e-18
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembly, Pr 8e-18
1iru_H205 20S proteasome; cell cycle, immune response, proteolysi 6e-17
1iru_M213 20S proteasome; cell cycle, immune response, proteolysi 1e-16
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, prot 2e-16
1ryp_I222 20S proteasome; multicatalytic proteinase, protein degr 1e-15
1iru_I234 20S proteasome; cell cycle, immune response, proteolysi 1e-15
1iru_L204 20S proteasome; cell cycle, immune response, proteolysi 4e-15
1ryp_H205 20S proteasome; multicatalytic proteinase, protein degr 3e-14
1ryp_N233 20S proteasome; multicatalytic proteinase, protein degr 6e-13
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: 8e-13
1ryp_K198 20S proteasome; multicatalytic proteinase, protein degr 1e-12
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, hydr 1e-11
1ryp_L212 20S proteasome; multicatalytic proteinase, protein degr 1e-11
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 proteasom 6e-11
1iru_C261 20S proteasome; cell cycle, immune response, proteolysi 9e-07
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A 3e-06
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A 9e-06
1iru_G254 20S proteasome; cell cycle, immune response, proteolysi 2e-05
1ryp_G244 20S proteasome; multicatalytic proteinase, protein degr 2e-05
1iru_B233 20S proteasome; cell cycle, immune response, proteolysi 5e-05
1ryp_C244 20S proteasome; multicatalytic proteinase, protein degr 7e-05
1iru_E241 20S proteasome; cell cycle, immune response, proteolysi 3e-04
3bdm_F287 Proteasome component C1; ubiquitin, proteolysis, pathog 4e-04
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assembly, P 7e-04
1iru_A246 20S proteasome; cell cycle, immune response, proteolysi 0.001
3h6i_A248 Proteasome (alpha subunit) PRCA; binding sites, oxazoli 0.001
1ryp_F233 20S proteasome; multicatalytic proteinase, protein degr 0.003
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* Length = 180 Back     alignment and structure
 Score =  172 bits (437), Expect = 4e-44
 Identities = 97/178 (54%), Positives = 129/178 (72%), Gaps = 4/178 (2%)

Query: 13  MHATTILTVRKDGVVVIAGDGQVSLGQTV-MKANARKVRRLGKGNIIAGFAGSSADAFTL 71
            HATTI  V+  G   ++GDGQV+ GQ V MK  ARKVR+L  G ++AGFAGS ADAFTL
Sbjct: 3   FHATTIFAVQHKGRSAMSGDGQVTFGQAVVMKHTARKVRKLFNGKVLAGFAGSVADAFTL 62

Query: 72  LERLEKKLEQYPNQLLRSSVELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPE 131
            E+ E KLE+Y   L R++VELAK+WR DK LR LEAM+++ ++   L+++G G+V+EP+
Sbjct: 63  FEKFEAKLEEYNGNLKRAAVELAKEWRSDKVLRKLEAMLIVMNQDTLLLVSGTGEVIEPD 122

Query: 132 NGVMAIGSGGSYALSAARALM---STQNSAEEIARKAMSIAADICVYTNHNIVLETLK 186
           +G++AIGSGG+YAL+A RAL        SA EIAR A+  A +ICVYTN  I+LE L+
Sbjct: 123 DGILAIGSGGNYALAAGRALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE 180


>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Length = 171 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Length = 174 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3hfa_H 2fhg_H* 2fhh_H 3h6i_C 3h6f_C 3hf9_H Length = 291 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 219 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 201 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 1g0u_I 1fnt_J 1z7q_J 2zcy_I* 3bdm_I* Length = 204 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 1g0u_L 2zcy_L* 3bdm_L* Length = 222 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 205 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 205 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 213 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* Length = 266 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3bdm_H* 1fnt_I* 2zcy_H* Length = 222 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 234 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 204 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* 3gpj_N* 3gpt_N* 3gpw_N* 3hye_N* Length = 205 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* Length = 233 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* Length = 198 Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 219 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1z7q_L 1g0u_K 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* 3hye_K* 1g65_K* Length = 212 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase/hydrolase activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 261 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 254 Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 1g0u_F Length = 244 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 233 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3bdm_B* 1z7q_C* 2zcy_B* 1g0u_B 1fnt_C Length = 244 Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 241 Back     alignment and structure
>3bdm_F Proteasome component C1; ubiquitin, proteolysis, pathogen, virulence factor, cytoplasm, hydrolase, nucleus, protease; HET: GDT; 2.70A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_G* 2zcy_F* 1z7q_G Length = 287 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Length = 246 Back     alignment and structure
>3h6i_A Proteasome (alpha subunit) PRCA; binding sites, oxazolidin-2-ONE, crystallography, X-RAY, protease inhibitors; 2.43A {Mycobacterium tuberculosis} PDB: 3h6f_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A Length = 248 Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3bdm_E* 1z7q_F 1fnt_F* 2zcy_E* 1g0u_E Length = 233 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target190 ATP-dependent protease peptidase subunit [Candidatus Li
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIle hyd 100.0
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic threo 100.0
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophi 100.0
1iru_M213 20S proteasome; cell cycle, immune response, proteolysi 100.0
1ryp_M222 20S proteasome; multicatalytic proteinase, protein degr 100.0
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosi 100.0
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembly, Pr 100.0
1ryp_H205 20S proteasome; multicatalytic proteinase, protein degr 100.0
1iru_I234 20S proteasome; cell cycle, immune response, proteolysi 100.0
1iru_H205 20S proteasome; cell cycle, immune response, proteolysi 100.0
1ryp_J204 20S proteasome; multicatalytic proteinase, protein degr 100.0
1ryp_I222 20S proteasome; multicatalytic proteinase, protein degr 100.0
1iru_L204 20S proteasome; cell cycle, immune response, proteolysi 100.0
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, prot 100.0
1iru_J205 20S proteasome; cell cycle, immune response, proteolysi 100.0
1iru_N219 20S proteasome; cell cycle, immune response, proteolysi 100.0
1ryp_L212 20S proteasome; multicatalytic proteinase, protein degr 100.0
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 proteasom 100.0
1ryp_N233 20S proteasome; multicatalytic proteinase, protein degr 100.0
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembly, Pr 100.0
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: 99.98
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, hydr 99.97
1iru_K201 20S proteasome; cell cycle, immune response, proteolysi 99.97
1iru_C261 20S proteasome; cell cycle, immune response, proteolysi 99.97
1ryp_C244 20S proteasome; multicatalytic proteinase, protein degr 99.97
1ryp_K198 20S proteasome; multicatalytic proteinase, protein degr 99.97
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm, hyd 99.96
1iru_B233 20S proteasome; cell cycle, immune response, proteolysi 99.96
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 proteaso 99.96
1ryp_B250 20S proteasome; multicatalytic proteinase, protein degr 99.96
1ryp_E242 20S proteasome; multicatalytic proteinase, protein degr 99.96
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A 99.95
1iru_E241 20S proteasome; cell cycle, immune response, proteolysi 99.95
1ryp_G244 20S proteasome; multicatalytic proteinase, protein degr 99.95
1iru_G254 20S proteasome; cell cycle, immune response, proteolysi 99.95
1ryp_D241 20S proteasome; multicatalytic proteinase, protein degr 99.95
3bdm_F287 Proteasome component C1; ubiquitin, proteolysis, pathog 99.95
1iru_F263 20S proteasome; cell cycle, immune response, proteolysi 99.95
1ryp_A243 20S proteasome; multicatalytic proteinase, protein degr 99.95
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lactones, 99.95
1iru_D248 20S proteasome; cell cycle, immune response, proteolysi 99.94
1iru_A246 20S proteasome; cell cycle, immune response, proteolysi 99.94
1ryp_F233 20S proteasome; multicatalytic proteinase, protein degr 99.94
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assembly, P 99.93
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* Back     alignment and structure
Probab=100.00  E-value=1.1e-39  Score=266.67  Aligned_cols=175  Identities=51%  Similarity=0.843  Sum_probs=156.6

Q ss_pred             EECCEEEEEEEECCEEEEEECCCCCCCCEEEECCCEEEEEECCCEEE-EEECCHHHHHHHHHHHHHHHHHHHCCCCCCCH
Q ss_conf             76371799999799799981365450536774451057981597599-97313058899999999999998536656306
Q gi|254780828|r   12 KMHATTILTVRKDGVVVIAGDGQVSLGQTVMKANARKVRRLGKGNII-AGFAGSSADAFTLLERLEKKLEQYPNQLLRSS   90 (190)
Q Consensus        12 ~~~GTTivgi~~~dgVviAaDtR~S~G~~v~sr~~~KI~~i~d~~~~-~g~ag~a~d~~~~~~~~~~~~~~~~~~~~~~~   90 (190)
                      ++||||||||+|+||||||||||+|+|+++.+|+.+|++++.++.++ ++.++...+.+.+.+....+.++++.......
T Consensus         2 ~~~GTTivavk~~~GVvlAaDtR~s~G~~i~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (180)
T 2z3b_A            2 SFHATTIFAVQHKGRSAMSGDGQVTFGQAVVMKHTARKVRKLFNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAA   81 (180)
T ss_dssp             CBCCCCEEEEEETTEEEEEECCCEEETTTEEEESCCCCEEEETTTTEEEEECSCHHHHHHHHHHHHHHHHHTTTCHHHHH
T ss_pred             CCCCEEEEEEEECCEEEEEECCCCCCCCEEEECCCEEEEEECCCCEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             97762899999999999998984427764897362379997169869953624678999999999999987515420149


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCCCCEECCCEEEEECCHHHHHHHHHHHHCCCC---CHHHHHHHHHH
Q ss_conf             799999976112220131045137876469980586311413279960642345788985207899---98999999999
Q gi|254780828|r   91 VELAKDWRMDKYLRNLEAMILIADKTITLVITGMGDVLEPENGVMAIGSGGSYALSAARALMSTQN---SAEEIARKAMS  167 (190)
Q Consensus        91 ~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~d~~g~~~~~~~~a~GSGs~~A~g~Le~~y~~~~---sa~ela~~Al~  167 (190)
                      ...++.+...+|.+++.+.+......+++++..++.+..++++|+|+|||+++|+|+||..|+|+|   +|+||+++||+
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~GSGs~~A~g~L~~~y~~~~~~~eA~~la~~Al~  161 (180)
T 2z3b_A           82 VELAKEWRSDKVLRKLEAMLIVMNQDTLLLVSGTGEVIEPDDGILAIGSGGNYALAAGRALKKHAGESMSASEIARAALE  161 (180)
T ss_dssp             HHHHHHHHHCTTGGGCCCCEEEECSSCEEEECTTCCEECCSSSEEEESTTHHHHHHHHHHHHHHHGGGCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCEEECCCCCEEECCCCEEEECCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             99999998866654125516787326753743785102046648984435799999999873558986679999999999


Q ss_pred             HHHCCCEEECCCEEEEEEE
Q ss_conf             7540110225956999994
Q gi|254780828|r  168 IAADICVYTNHNIVLETLK  186 (190)
Q Consensus       168 ~A~erDvyTgd~i~i~~i~  186 (190)
                      +|+|||||||||++|++||
T Consensus       162 ~Aae~diyT~~~~~v~~~~  180 (180)
T 2z3b_A          162 TAGEICVYTNDQIILEELE  180 (180)
T ss_dssp             HHHHHCTTCCSCCEEEEEC
T ss_pred             HHHHHCEECCCCEEEEEEC
T ss_conf             9875228809958999839



>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 1g0u_L 2zcy_L* ... Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* 3gpj_N* 3gpt_N* 3gpw_N* ... Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 1g0u_I 1fnt_J 1z7q_J 2zcy_I* ... Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3bdm_H* 1fnt_I* ... Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g0u_K 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* 3hye_K* ... Back     alignment and structure