254780833

254780833

hypothetical protein CLIBASIA_03630

GeneID in NCBI database:8209844Locus tag:CLIBASIA_03630
Protein GI in NCBI database:254780833Protein Accession:YP_003065246.1
Gene range:+(796162, 797277)Protein Length:371aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:von Willebrand factor type A
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYNK
cccEEHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccEEcccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccEEccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccEEEEEEccccccEEEEEEEEcccEEEEEEccHHccccccccEcccccEcccccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcHHcccccccHEEEEEEEEEccccEcccccccccccEEHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccHHEEHHHHHHHcccEEEEEEEEcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILnqengnngkkqkndFSYRIIKNIWQTDFRNelrengfaqdinnierstslsiiiddqhkdynlsavsryempfifctfpwcansshapllitssvkissksdiglDMMMVLDVSLsmndhfgpgmdklGVATRSIREMLDIIksipdvnnvVRSGLVTFSSKIvqtfplawgvQHIQEKINRLIfgsttkstpgleyAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTdgensspnidnkeslfyCNEAKRRGAIVYAIGVQAEAADQFLkncaspdrfysvqnSRKLHDAFLRIGKEMVKQRILYNK
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKIlnqengnngkkqkndfsYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIksipdvnnVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLifgsttkstpgLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTdgensspnidNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGkemvkqrilynk
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILnqengnngkkqknDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYNK
*SF*N**NFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKI***********QKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTS*************LSAVSRYEMPFIFCTFPWCANSSHAPLL***********DIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDA************DYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYN*
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYNK
*SFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYNK
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYNK
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYNK
MSFLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSAVSRYEMPFIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKEMVKQRILYNK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Li 1e-116
254781108398 von Willebrand factor type A [Candidatus Liberibac 2e-21
254780388458 hypothetical protein CLIBASIA_01365 [Candidatus Li 1e-20
254780388458 hypothetical protein CLIBASIA_01365 [Candidatus Li 5e-05
254781110420 von Willebrand factor type A [Candidatus Liberibac 3e-12
>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment
 Score =  408 bits (1048), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/370 (54%), Positives = 273/370 (73%), Gaps = 3/370 (0%)

Query: 4   LNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKI 63
           LNIRNFFYN KG ++ILTAI LP+IF+V+G++IE SH FF+K  LH ++D SL++ AT+I
Sbjct: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65

Query: 64  LNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHK 123
           +N+ NGNN KK K       IKN W   FRNELR+NGF  DI++I RSTSL I++  Q++
Sbjct: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125

Query: 124 DYNLSAVSRYEMPFIFCTF-PWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMN 182
            Y++SA+SRY++P  FCTF PW  NS H  + ITSSVK++S++D  LDMM+VLDVS SM 
Sbjct: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185

Query: 183 DHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQE 242
             F   + K+ +A +SI  ML+ +K IPDVNNVV+SGLVTFS+KI + F L WGV H+Q 
Sbjct: 186 SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQR 245

Query: 243 KINRLI-FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNID 301
           KI  L  FG +T STPGL+YAYN+IFD +   +H      +YKK I+F+TDGEN S   +
Sbjct: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK-E 304

Query: 302 NKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKE 361
           +++SL+YCNEAK+RGAIVYAIG++   + +FL+ CASP+ FY V+N   ++DAF  IGK+
Sbjct: 305 DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKD 364

Query: 362 MVKQRILYNK 371
           +V +RI Y+K
Sbjct: 365 IVTKRIWYDK 374

>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 185/401 (46%), Gaps = 62/401 (15%)

Query: 20  LTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDF 79
           +TAI++ V F+ +   I+ +H  +++ ++   LD ++L     I++     +   +K+  
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60

Query: 80  SYRIIKNIWQTDFRNELRENGF-AQDINNIERSTSLSIIIDDQHK-DYNLSAVSRYEMP- 136
           S      I++   +  L++  +  ++  +I +   ++I  D  +   Y   + ++YE+P 
Sbjct: 61  S-----TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115

Query: 137 ---FIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHF-------- 185
              F+    P     ++  L  T  ++ SS+ ++ + + MVLDVS SM D +        
Sbjct: 116 ENLFLKGLIPSAL--TNLSLRSTGIIERSSE-NLAISICMVLDVSRSMEDLYLQKHNDNN 172

Query: 186 -------------------------------GPGMDKLGVATRSIREMLDII-KSIPDVN 213
                                           P   K+ V   S   +++ I K+I +  
Sbjct: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232

Query: 214 NV-VRSGLVTFSSKIV--QTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAK 270
           N+ VR G + ++  IV  Q  PL+  +  ++ ++N+L     T + P + +AY ++++ K
Sbjct: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292

Query: 271 EKLEHIAKGHDDYKKYIIFLTDGENSSPNI--DNKESLFYCNEAKRRGAIVYAIGVQAEA 328
           E   H   G    KK++IF+TDGENS  +   +   +L  C   +  G  +Y++ V A  
Sbjct: 293 ES-SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351

Query: 329 ADQ-FLKNCA-SPDRFYSVQNSRKLHDAFLRIGKEMVKQRI 367
             Q  L+ C  S  +F++V +SR+L ++F +I  ++ +Q +
Sbjct: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392

>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score = 92.0 bits (227), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 92/178 (51%), Gaps = 16/178 (8%)

Query: 206 IKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLI------FGSTTKSTPGL 259
           IK I +VN+ VR G   F+ +++     +WGV  +   I +         GST  +   +
Sbjct: 285 IKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAIND-AM 343

Query: 260 EYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIV 319
           + AY+ I  + E   H  K + + KKYI+ LTDGEN+    DN+E +  CN+AK +G  +
Sbjct: 344 QTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQ---DNEEGIAICNKAKSQGIRI 400

Query: 320 YAIG-----VQAEAADQFLKNCASPDRFYSVQNSRKLHDAFL-RIGKEMVKQRILYNK 371
             I       Q E A  FL NCASP+ F+   ++ +L+  F  RIG E+ ++ I   K
Sbjct: 401 MTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK 458

>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score = 40.4 bits (93), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 86/179 (48%), Gaps = 9/179 (5%)

Query: 12  NCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNN 71
           +C G   I+TA+L+PV+  V G++++     + +  L      +++ TA+  L Q     
Sbjct: 17  SCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAII-TASVPLIQSLEEV 75

Query: 72  GKKQKNDFSY--RIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSA 129
             + KN F++  + I+     +F N L++N   +++ +I R T++   ++ +   Y +  
Sbjct: 76  SSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVE--MNPRKSAYQVVL 133

Query: 130 VSRYEMPFIFCTFPWCANSSHAPLLIT----SSVKISSKSDIGLDMMMVLDVSLSMNDH 184
            SRY++     +    +    + L+ T     +V  S   + G+ +  V+D S SM D+
Sbjct: 134 SSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDY 192

>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Back     alignment
 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 92/189 (48%), Gaps = 15/189 (7%)

Query: 191 KLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINR---- 246
           K+     ++   LD I  +  V   V  GL+ +++++ +    +WG + +++ + R    
Sbjct: 227 KMAALKNALLLFLDSIDLLSHVKEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDS 286

Query: 247 LIFGSTTKSTPGLEYAYNKIFDAKEK-------LEHIAKGHDDYKKYIIFLTDGENSSPN 299
           LI    T STP ++ AY  +   K++        + +      ++K+IIFLTDGEN++  
Sbjct: 287 LIL-KPTDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFK 345

Query: 300 IDNKESLFYCNEAKRRGAIVYAIGVQAEAADQ-FLKNC-ASPDRFYSVQNSRKLHDAFLR 357
             N  ++  C++AK     +  I + A    Q  LK C +SP+  Y+V N+  L   F  
Sbjct: 346 -SNVNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQN 404

Query: 358 IGKEMVKQR 366
           I + MV ++
Sbjct: 405 ISQLMVHRK 413

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Liberib 1 1e-112
315122347362 hypothetical protein CKC_02995 [Candidatus Liberibacter 1 3e-46
163760496363 hypothetical protein HPDFL43_04296 [Hoeflea phototrophi 1 1e-20
254781108398 von Willebrand factor type A [Candidatus Liberibacter a 1 2e-17
254780388458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib 1 1e-16
222087111401 hypothetical protein Arad_3867 [Agrobacterium radiobact 1 3e-16
307945905432 putative von Willebrand factor type A [Roseibium sp. Tr 1 4e-14
241206334400 hypothetical protein Rleg_3648 [Rhizobium leguminosarum 1 5e-14
315122199463 hypothetical protein CKC_02245 [Candidatus Liberibacter 1 7e-14
327189644415 hypothetical protein RHECNPAF_570041 [Rhizobium etli CN 1 4e-11
>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment and organism information
 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/370 (54%), Positives = 273/370 (73%), Gaps = 3/370 (0%)

Query: 4   LNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKI 63
           LNIRNFFYN KG ++ILTAI LP+IF+V+G++IE SH FF+K  LH ++D SL++ AT+I
Sbjct: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65

Query: 64  LNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHK 123
           +N+ NGNN KK K       IKN W   FRNELR+NGF  DI++I RSTSL I++  Q++
Sbjct: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125

Query: 124 DYNLSAVSRYEMPFIFCTF-PWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMN 182
            Y++SA+SRY++P  FCTF PW  NS H  + ITSSVK++S++D  LDMM+VLDVS SM 
Sbjct: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185

Query: 183 DHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQE 242
             F   + K+ +A +SI  ML+ +K IPDVNNVV+SGLVTFS+KI + F L WGV H+Q 
Sbjct: 186 SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQR 245

Query: 243 KINRLI-FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNID 301
           KI  L  FG +T STPGL+YAYN+IFD +   +H      +YKK I+F+TDGEN S   +
Sbjct: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK-E 304

Query: 302 NKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKE 361
           +++SL+YCNEAK+RGAIVYAIG++   + +FL+ CASP+ FY V+N   ++DAF  IGK+
Sbjct: 305 DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKD 364

Query: 362 MVKQRILYNK 371
           +V +RI Y+K
Sbjct: 365 IVTKRIWYDK 374


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 362 Back     alignment and organism information
>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43] Length = 363 Back     alignment and organism information
>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment and organism information
>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment and organism information
>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84] Length = 401 Back     alignment and organism information
>gi|307945905|ref|ZP_07661241.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4] Length = 432 Back     alignment and organism information
>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 400 Back     alignment and organism information
>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 463 Back     alignment and organism information
>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512] Length = 415 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib
smart00327177 smart00327, VWA, von Willebrand factor (vWF) type A dom 1e-12
cd01450161 cd01450, vWFA_subfamily_ECM, Von Willebrand factor type 3e-08
pfam00092177 pfam00092, VWA, von Willebrand factor type A domain 5e-08
cd01474185 cd01474, vWA_ATR, ATR (Anthrax Toxin Receptor): Anthrax 5e-06
cd01467180 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand f 6e-06
COG4245207 COG4245, TerY, Uncharacterized protein encoded in toxic 1e-05
cd01456206 cd01456, vWA_ywmD_type, VWA ywmD type:Von Willebrand fa 2e-05
cd01464176 cd01464, vWA_subfamily, VWA subfamily: Von Willebrand f 2e-04
cd01475224 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous p 0.001
cd01472164 cd01472, vWA_collagen, von Willebrand factor (vWF) type 0.002
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) domai 1e-10
>gnl|CDD|128622 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|29223 cd01450, vWFA_subfamily_ECM, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain Back     alignment and domain information
>gnl|CDD|29247 cd01474, vWA_ATR, ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>gnl|CDD|29240 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|33968 COG4245, TerY, Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|29229 cd01456, vWA_ywmD_type, VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|29237 cd01464, vWA_subfamily, VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|29248 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>gnl|CDD|29245 cd01472, vWA_collagen, von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>gnl|CDD|29222 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib
PRK13685326 hypothetical protein; Provisional 99.96
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor type A 99.95
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor type 99.94
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin 99.91
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor ty 99.9
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type 99.88
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel like: V 99.87
cd01470198 vWA_complement_factors Complement factors B and C2 are 99.87
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extr 99.87
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) typ 99.86
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor type 99.86
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is 99.85
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelata 99.83
pfam00092177 VWA von Willebrand factor type A domain. 99.79
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA doma 99.79
cd01469177 vWA_integrins_alpha_subunit Integrins are a class of ad 99.78
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhe 99.78
cd01471186 vWA_micronemal_protein Micronemal proteins: The Toxopla 99.77
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. Memb 99.77
cd01472164 vWA_collagen von Willebrand factor (vWF) type A domain; 99.77
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) li 99.73
TIGR00868 874 hCaCC calcium-activated chloride channel protein 1; Int 99.72
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extracellula 99.72
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebrates) 99.69
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] 99.59
COG4245207 TerY Uncharacterized protein encoded in toxicity protec 99.51
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand facto 99.49
TIGR02442688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 99.3
KOG2353 1104 consensus 99.12
PRK13406584 bchD magnesium chelatase subunit D; Provisional 99.11
TIGR02031705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 99.09
cd01453183 vWA_transcription_factor_IIH_type Transcription factors 98.89
pfam00362424 Integrin_beta Integrin, beta chain. Integrins have been 98.73
COG4548637 NorD Nitric oxide reductase activation protein [Inorgan 98.69
smart00187423 INB Integrin beta subunits (N-terminal portion of extra 98.68
pfam11775220 CobT_C Cobalamin biosynthesis protein CobT VWA domain. 98.62
pfam04056250 Ssl1 Ssl1-like. Ssl1-like proteins are 40kDa subunits o 98.32
COG2425437 Uncharacterized protein containing a von Willebrand fac 98.21
COG2304 399 Uncharacterized protein containing a von Willebrand fac 98.08
KOG2807 378 consensus 98.06
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) do 98.02
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a major 97.9
KOG3768 888 consensus 97.77
pfam06707206 DUF1194 Protein of unknown function (DUF1194). This fam 97.72
cd01460266 vWA_midasin VWA_Midasin: Midasin is a member of the AAA 97.58
pfam04285421 DUF444 Protein of unknown function (DUF444). Bacterial 97.52
PRK05325414 hypothetical protein; Provisional 97.47
COG4867652 Uncharacterized protein with a von Willebrand factor ty 96.92
COG5151 421 SSL1 RNA polymerase II transcription initiation/nucleot 96.02
KOG2884259 consensus 95.96
COG2718423 Uncharacterized conserved protein [Function unknown] 95.37
pfam03731222 Ku_N Ku70/Ku80 N-terminal alpha/beta domain. The Ku het 94.43
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) d 99.78
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was orig 99.72
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type 99.64
cd01454174 vWA_norD_type norD type: Denitrifying bacteria contain 99.5
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor 98.79
pfam05762223 VWA_CoxE VWA domain containing CoxE-like protein. This 97.74
KOG1226 783 consensus 97.68
cd01459254 vWA_copine_like VWA Copine: Copines are phospholipid-bi 96.97
pfam11443524 DUF2828 Domain of unknown function (DUF2828). This is a 96.85
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heterodime 96.75
KOG1327529 consensus 96.47
TIGR01651606 CobT cobaltochelatase, CobT subunit; InterPro: IPR00653 96.37
pfam07002145 Copine Copine. This family represents a conserved regio 96.14
PRK10997484 yieM hypothetical protein; Provisional 95.7
pfam11265219 Med25_VWA Mediator complex subunit 25 von Willebrand fa 92.56
COG4961185 TadG Flp pilus assembly protein TadG [Intracellular tra 99.42
COG4655 565 Predicted membrane protein [Function unknown] 97.98
pfam0781143 TadE TadE-like protein. The members of this family are 96.55
pfam09967412 DUF2201 Predicted metallopeptidase (DUF2201). This doma 97.23
TIGR02877392 spore_yhbH sporulation protein YhbH; InterPro: IPR01423 95.89
COG3552395 CoxE Protein containing von Willebrand factor type A (v 93.91
COG3864396 Uncharacterized protein conserved in bacteria [Function 92.39
COG4547620 CobT Cobalamin biosynthesis protein CobT (nicotinate-mo 96.79
TIGR00873 480 gnd 6-phosphogluconate dehydrogenase, decarboxylating; 95.52
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 92.66
LOAD_ku 521 consensus 90.69
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>pfam00092 VWA von Willebrand factor type A domain Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1; InterPro: IPR004727 This entry represents a family of Ca(2+)-regulated chloride channels (CLCA) which includes bovine, murine and human proteins , Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR012804 Cobalamin (vitamin B12) can be complexed with metal via ATP-dependent reactions (aerobic pathway) (e Back     alignment and domain information
>KOG2353 consensus Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D; InterPro: IPR011776 This entry represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>pfam00362 Integrin_beta Integrin, beta chain Back     alignment and domain information
>COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) Back     alignment and domain information
>pfam11775 CobT_C Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>pfam04056 Ssl1 Ssl1-like Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG2807 consensus Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>KOG3768 consensus Back     alignment and domain information
>pfam06707 DUF1194 Protein of unknown function (DUF1194) Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>pfam04285 DUF444 Protein of unknown function (DUF444) Back     alignment and domain information
>PRK05325 hypothetical protein; Provisional Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2884 consensus Back     alignment and domain information
>COG2718 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>pfam05762 VWA_CoxE VWA domain containing CoxE-like protein Back     alignment and domain information
>KOG1226 consensus Back     alignment and domain information
>cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium Back     alignment and domain information
>pfam11443 DUF2828 Domain of unknown function (DUF2828) Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>KOG1327 consensus Back     alignment and domain information
>TIGR01651 CobT cobaltochelatase, CobT subunit; InterPro: IPR006538 These proteins are CobT subunits of the aerobic cobalt chelatase (aerobic cobalamin biosynthesis pathway) Back     alignment and domain information
>pfam07002 Copine Copine Back     alignment and domain information
>PRK10997 yieM hypothetical protein; Provisional Back     alignment and domain information
>pfam11265 Med25_VWA Mediator complex subunit 25 von Willebrand factor type A Back     alignment and domain information
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4655 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam07811 TadE TadE-like protein Back     alignment and domain information
>pfam09967 DUF2201 Predicted metallopeptidase (DUF2201) Back     alignment and domain information
>TIGR02877 spore_yhbH sporulation protein YhbH; InterPro: IPR014230 Proteins in this entry, typified by YhbH from Bacillus subtilis, are found in the genomes of nearly every endospore-forming bacterium, and in no other genomes Back     alignment and domain information
>COG3552 CoxE Protein containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG3864 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4547 CobT Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating; InterPro: IPR006113 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information
>LOAD_ku consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib
3n2n_F185 The Crystal Structure Of Tumor Endothelial Marker 8 1e-09
1tzn_a181 Crystal Structure Of The Anthrax Toxin Protective A 8e-07
1shu_X182 Crystal Structure Of The Von Willebrand Factor A Do 8e-07
1sht_X181 Crystal Structure Of The Von Willebrand Factor A Do 9e-07
1t6b_Y189 Crystal Structure Of B. Anthracis Protective Antige 1e-05
1bhq_1189 Mac-1 I Domain Cadmium Complex Length = 189 9e-05
1idn_1190 Mac-1 I Domain Metal Free Length = 190 9e-05
1na5_A197 Integrin Alpha M I Domain Length = 197 9e-05
1mf7_A194 Integrin Alpha M I Domain Length = 194 9e-05
1jlm_A192 I-Domain From Integrin Cr3, Mn2+ Bound Length = 192 9e-05
2xwb_F 732 Crystal Structure Of Complement C3b In Complex With 2e-04
3hrz_D 741 Cobra Venom Factor (Cvf) In Complex With Human Fact 2e-04
2win_I 507 C3 Convertase (C3bbb) Stabilized By Scin Length = 5 3e-04
2ok5_A 752 Human Complement Factor B Length = 752 3e-04
1ido_A189 I-Domain From Integrin Cr3, Mg2+ Bound Length = 189 4e-04
1m1u_A195 An Isoleucine-Based Allosteric Switch Controls Affi 4e-04
1n9z_A192 Integrin Alpha M I Domain Mutant Length = 192 8e-04
1n3y_A198 Crystal Structure Of The Alpha-X Beta2 Integrin I D 0.001
1q0p_A223 A Domain Of Factor B Length = 223 0.002
3k6s_A 1095 Structure Of Integrin Alphaxbeta2 Ectodomain Length 3e-06
>gi|316983245|pdb|3N2N|F Chain F, The Crystal Structure Of Tumor Endothelial Marker 8 (Tem8) Extracellular Domain Length = 185 Back     alignment and structure
 Score = 69.2 bits (167), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 72/205 (35%), Gaps = 27/205 (13%)

Query: 162 SSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLV 221
           S     G D+  +LD S S+  H+                      +   ++  +R   +
Sbjct: 1   SMACYGGFDLYFILDKSGSVLHHWNE------------IYYFVEQLAHKFISPQLRMSFI 48

Query: 222 TFSSKIVQTFPLAWGVQHIQEKINRLI---FGSTTKSTPGLEYAYNKIFDAKEKLEHIAK 278
            FS++      L    + I++ +  L     G  T    G E A  +I        +  +
Sbjct: 49  VFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQI-------YYENR 101

Query: 279 GHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCA- 337
                   II LTDGE          S    N ++  GAIVYA+GV  +  +  L   A 
Sbjct: 102 QGYRTASVIIALTDGELH--EDLFFYSEREANRSRDLGAIVYAVGV-KDFNETQLARIAD 158

Query: 338 SPDRFYSVQN-SRKLHDAFLRIGKE 361
           S D  + V +  + L      I K+
Sbjct: 159 SKDHVFPVNDGFQALQGIIHSILKK 183


>gi|52695907|pdb|1TZN|AA Chain a, Crystal Structure Of The Anthrax Toxin Protective Antigen Heptameric Prepore Bound To The Vwa Domain Of Cmg2, An Anthrax Toxin Receptor Length = 181 Back     alignment and structure
>gi|48425689|pdb|1SHU|X Chain X, Crystal Structure Of The Von Willebrand Factor A Domain Of Human Capillary Morphogenesis Protein 2: An Anthrax Toxin Receptor Length = 182 Back     alignment and structure
>gi|48425688|pdb|1SHT|X Chain X, Crystal Structure Of The Von Willebrand Factor A Domain Of Human Capillary Morphogenesis Protein 2: An Anthrax Toxin Receptor Length = 181 Back     alignment and structure
>gi|51247575|pdb|1T6B|Y Chain Y, Crystal Structure Of B. Anthracis Protective Antigen Complexed With Human Anthrax Toxin Receptor Length = 189 Back     alignment and structure
>gi|157838288|pdb|1BHQ|1 Chain 1, Mac-1 I Domain Cadmium Complex Length = 189 Back     alignment and structure
>gi|253722212|pdb|1IDN|1 Chain 1, Mac-1 I Domain Metal Free Length = 190 Back     alignment and structure
>gi|31615654|pdb|1NA5|A Chain A, Integrin Alpha M I Domain Length = 197 Back     alignment and structure
>gi|31615583|pdb|1MF7|A Chain A, Integrin Alpha M I Domain Length = 194 Back     alignment and structure
>gi|157831557|pdb|1JLM|A Chain A, I-Domain From Integrin Cr3, Mn2+ Bound Length = 192 Back     alignment and structure
>gi|317455060|pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>gi|251837060|pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>gi|239781743|pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507 Back     alignment and structure
>gi|134105218|pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>gi|157831431|pdb|1IDO|A Chain A, I-Domain From Integrin Cr3, Mg2+ Bound Length = 189 Back     alignment and structure
>gi|22219356|pdb|1M1U|A Chain A, An Isoleucine-Based Allosteric Switch Controls Affinity And Shape Shifting In Integrin Cd11b A-Domain Length = 195 Back     alignment and structure
>gi|31615649|pdb|1N9Z|A Chain A, Integrin Alpha M I Domain Mutant Length = 192 Back     alignment and structure
>gi|28948724|pdb|1N3Y|A Chain A, Crystal Structure Of The Alpha-X Beta2 Integrin I Domain Length = 198 Back     alignment and structure
>gi|47168593|pdb|1Q0P|A Chain A, A Domain Of Factor B Length = 223 Back     alignment and structure
>gi|283807143|pdb|3K6S|A Chain A, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 1095 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 7e-16
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sapiens 5e-13
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 9e-13
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 2e-11
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 3e-11
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 2e-10
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 9e-10
1pt6_A213 Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.8 8e-09
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold, mem 2e-08
3gxb_A184 VON willebrand factor; VWA-like fold, blood coagulation 4e-07
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1.30A { 2e-06
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, antagonis 4e-06
2b2x_A223 Integrin alpha-1; computational design, antibody-antige 8e-06
3k6s_A 1095 Integrin alpha-X; hetero dimer, cell receptor, adhesion 4e-05
1atz_A189 VON willebrand factor; collagen-binding, hemostasis, di 6e-05
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; nucle 0.001
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacteriochl 2e-09
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hydrola 5e-09
2nvo_A535 RO sixty-related protein, RSR; alpha helical repeats, V 2e-06
2iue_A212 Pactolus I-domain; membrane protein, CD, ITC, limbs, mi 0.003
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
 Score = 80.3 bits (197), Expect = 7e-16
 Identities = 40/221 (18%), Positives = 83/221 (37%), Gaps = 28/221 (12%)

Query: 160 KISSKSDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSG 219
           KI  +    L++ ++LD S S+++      +   +   S   M+D I S     +V    
Sbjct: 1   KIQIQRSGHLNLYLLLDASQSVSE------NDFLIFKESASLMVDRIFSFEINVSV---A 51

Query: 220 LVTFSSKIVQTFPLAWG----VQHIQEKINRLIF-----GSTTKSTPGLEYAYNKIFDAK 270
           ++TF+S+      +       +  +   +    +     G+ T +   L   Y  + +  
Sbjct: 52  IITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQM 111

Query: 271 EKLEHIAKGHDDYKKYIIFLTD-----GENSSPNIDNKESLFYCNEAKRRGAIVYAIGV- 324
             L        + +  II LTD     G +    +D+   +   N+ +     +YAIGV 
Sbjct: 112 RLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVG 171

Query: 325 QAEAADQFLKNCAS----PDRFYSVQNSRKLHDAFLRIGKE 361
           + +   + L    S        + +Q+++ LH  F  +   
Sbjct: 172 KLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDV 212


>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Length = 741 Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Length = 223 Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Length = 202 Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Length = 198 Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Length = 194 Back     alignment and structure
>1pt6_A Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Length = 213 Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Length = 182 Back     alignment and structure
>3gxb_A VON willebrand factor; VWA-like fold, blood coagulation, cell adhesion, cleavage on PAIR of basic residues, disease mutation, disulfide bond; HET: NAG; 1.90A {Homo sapiens} Length = 184 Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Escherichia coli} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3f78_A* ... Length = 179 Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Length = 200 Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Length = 223 Back     alignment and structure
>3k6s_A Integrin alpha-X; hetero dimer, cell receptor, adhesion molecule, calcium, cell adhesion, disulfide bond, glycoprotein, magnesium, membrane; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Length = 1095 Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 2adf_A 1fe8_A 1ao3_A Length = 189 Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Length = 192 Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Length = 189 Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Length = 178 Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans} Length = 535 Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Length = 212 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 99.91
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sapiens 99.88
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 99.88
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold, mem 99.85
3ibs_A218 Conserved hypothetical protein BATB; structural genomic 99.85
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 99.84
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, antagonis 99.83
1pt6_A213 Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.8 99.83
3gxb_A184 VON willebrand factor; VWA-like fold, blood coagulation 99.81
2b2x_A223 Integrin alpha-1; computational design, antibody-antige 99.81
1atz_A189 VON willebrand factor; collagen-binding, hemostasis, di 99.8
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 99.79
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 99.78
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 99.77
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; nucle 99.71
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hydrola 99.62
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1.30A { 99.58
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacteriochl 99.55
2iue_A212 Pactolus I-domain; membrane protein, CD, ITC, limbs, mi 99.47
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule, cel 99.41
2vdr_B 461 Integrin beta-3; cell adhesion/immune system, alternati 99.11
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EGF dom 99.06
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, cell 98.71
3efo_B 770 SEC24 related gene family, member D; copii, coat protei 96.3
3eh2_A 766 Protein transport protein SEC24C; copii-coat protein, v 94.7
3eh1_A 751 Protein transport protein SEC24B; copii coat protein, v 94.55
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SEC24 p 94.18
1m2o_A 768 SEC23, protein transport protein SEC23, SEC23P; zinc-fi 94.01
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomyces c 91.75
2nut_A 769 Protein transport protein SEC23A; human copii SEC23/24 90.18
2nvo_A535 RO sixty-related protein, RSR; alpha helical repeats, V 98.85
1jey_B 565 KU80; double-strand DNA break repair, non-homologous EN 98.69
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kD 98.5
1jey_A 609 KU70; double-strand DNA break repair, non-homologous EN 96.69
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
Probab=99.91  E-value=4.4e-23  Score=156.40  Aligned_cols=187  Identities=19%  Similarity=0.229  Sum_probs=145.6

Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCCEEECCCCC----CHHHH
Q ss_conf             34674069985276311566787214898999998750023355553110479878863674178166655----87899
Q gi|254780833|r  165 SDIGLDMMMVLDVSLSMNDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAW----GVQHI  240 (371)
Q Consensus       165 ~~~~idi~~viD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~lt~----~~~~~  240 (371)
                      ....+|++|++|.|+||..      ++++.+++++..+++.+...+   ..+|++++.|++.+....+|+.    +...+
T Consensus         6 ~~g~~DivfvlD~SgSm~~------~~~~~~k~~~~~~i~~~~~~~---~~~rv~lv~fs~~~~~~~~l~~~~~~~~~~~   76 (509)
T 2odp_A            6 RSGHLNLYLLLDASQSVSE------NDFLIFKESASLMVDRIFSFE---INVSVAIITFASEPKVLMSVLNDNSRDMTEV   76 (509)
T ss_dssp             SSSEEEEEEEEECSTTSCH------HHHHHHHHHHHHHHHHHHTTC---CCEEEEEEEESSSEEEEECTTSGGGGCHHHH
T ss_pred             CCCCEEEEEEEECCCCCCH------HHHHHHHHHHHHHHHHHCCCC---CCCEEEEEEECCEEEEEEECCCCCCCCHHHH
T ss_conf             7898659999978699998------999999999999999614489---9748999998883579971788875579999


Q ss_pred             HHHHHCCC-----CCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHH----
Q ss_conf             99974015-----688745642378899998742110123467776661699998404588888897899999999----
Q gi|254780833|r  241 QEKINRLI-----FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNE----  311 (371)
Q Consensus       241 ~~~i~~l~-----~~g~T~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~k~ivl~TDG~~~~~~~~~~~~~~~c~~----  311 (371)
                      ...|+.+.     .+|+|++..|+..+++.+..............++.+|+|||||||.+|.+.........+.+.    
T Consensus        77 ~~~i~~i~~~~~~~~g~T~~~~Al~~a~~~~~~~~~~~~~~~~~~~~~~~~iillTDG~~n~g~~~~~~~~~~~~~~~~~  156 (509)
T 2odp_A           77 ISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNIN  156 (509)
T ss_dssp             HHHHHTCCGGGGTTCCSCCHHHHHHHHHHHHHHHHHHHCTTSHHHHTEEEEEEEESCSCCCSSSCTHHHHHHHHHHTTCC
T ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99997173456778997779999999999999876430235566678862999994887566998489999987666665


Q ss_pred             -HHHCCCEEEEEEECC-CCCHHHHHHHCC-C---CEEEEECCHHHHHHHHHHHHH
Q ss_conf             -997898799999418-642798998338-9---808982898999999999999
Q gi|254780833|r  312 -AKRRGAIVYAIGVQA-EAADQFLKNCAS-P---DRFYSVQNSRKLHDAFLRIGK  360 (371)
Q Consensus       312 -~k~~gi~i~tIg~~~-~~~~~~l~~cAs-~---~~~y~~~~~~~L~~af~~I~~  360 (371)
                       +++++|.||+||+|. +.+...|+.+|| +   .|+|.+++.++|.++|++|-.
T Consensus       157 ~~~~~~v~i~~igvG~~~~d~~~L~~ias~~~~~~h~f~~~~~~~L~~~~~~i~~  211 (509)
T 2odp_A          157 QKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLD  211 (509)
T ss_dssp             STTGGGEEEEEEEESSSCCCHHHHHHHSCCCTTCCCEEEESSHHHHHHHHHHHEE
T ss_pred             HHHCCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHCCC
T ss_conf             6630696599999588645899999986599997159994888899999974044



>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for structural genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1pt6_A Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>3gxb_A VON willebrand factor; VWA-like fold, blood coagulation, cell adhesion, cleavage on PAIR of basic residues, disease mutation, disulfide bond; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>2vdr_B Integrin beta-3; cell adhesion/immune system, alternative splicing, platelet integrin ALPHAIIBBETA3, polymorphism, glycoprotein, cell adhesion, calcium; HET: NAG MAN; 2.40A {Homo sapiens} PDB: 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, alternative splicing, cell adhesion, disease mutation, glycoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B Back     alignment and structure
>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} Back     alignment and structure
>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure